Homology Contig-U14690-1 vs Protein

Query= Contig-U14690-1 (Contig-U14690-1Q) /CSM_Contig/Contig-U14690-1Q.Seq.d
         (1088 letters)

Database: nrp_B
           3,236,559 sequences; 1,051,180,864 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

(P22698) RecName: Full=Spore germination protein 270-11;  &B3562...    37   1.6
(Q1RML2) RecName: Full=1-phosphatidylinositol-4,5-bisphosphate p...    35   3.5
AB369537_1(AB369537|pid:none) Coturnix japonica plcz mRNA for ph...    34   7.9

>(P22698) RecName: Full=Spore germination protein 270-11;
           &B35621(B35621) &M33862_1(M33862|pid:none)
          Length = 532

 Score = 36.6 bits (83), Expect = 1.6
 Identities = 19/66 (28%), Positives = 35/66 (53%), Gaps = 2/66 (3%)
 Frame = +3

Query: 723 HIINIKVTLTNNESSPIKSIEIHSDNWNPTEFWNIVRSQKTGNLSF--PPFVVNLQAGDS 896
           H I ++ T+ N  S+PI S   +SD     + W++   +KTG  ++  P +   +  G S
Sbjct: 457 HYIQVEATIVNQGSTPISSFNFYSD---AEQIWSV---EKTGTNTYKLPSWFSTIPVGGS 510

Query: 897 FSFGFV 914
            +FG++
Sbjct: 511 HTFGYI 516

Lambda     K      H
   0.318    0.134    0.401

Gapped
Lambda     K      H
   0.267   0.0410    0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3236559
Number of Hits to DB: 1,271,883,404
Number of extensions: 20586353
Number of successful extensions: 48743
Number of sequences better than 10.0: 3
Number of HSP's gapped: 48736
Number of HSP's successfully gapped: 3
Length of query: 362
Length of database: 1,051,180,864
Length adjustment: 130
Effective length of query: 232
Effective length of database: 630,428,194
Effective search space: 146259341008
Effective search space used: 146259341008
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)