Homology Contig-U14644-1 vs Protein
Query= Contig-U14644-1 (Contig-U14644-1Q) /CSM_Contig/Contig-U14644-1Q.Seq.d
(439 letters)
Database: nrp_B
3,236,559 sequences; 1,051,180,864 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
EU682403_12(EU682403|pid:none) Panonychus ulmi mitochondrion, co... 35 1.1
CP000227_399(CP000227|pid:none) Bacillus cereus Q1, complete gen... 33 4.0
AP009180_102(AP009180|pid:none) Candidatus Carsonella ruddii PV ... 32 5.3
AM910983_19(AM910983|pid:none) Plasmodium knowlesi strain H chro... 32 9.0
>EU682403_12(EU682403|pid:none) Panonychus ulmi mitochondrion,
complete genome.
Length = 517
Score = 34.7 bits (78), Expect = 1.1
Identities = 15/44 (34%), Positives = 25/44 (56%)
Frame = -1
Query: 151 QLIYSFLFFLNIIIIKCEFSFFLKRVIYIFFFFMIYNEIKIKIK 20
+L + F++N + K FSF L +I +F+ M+YN +IK
Sbjct: 384 KLNFKIKFYINFFVKKSNFSFLLMNLISLFYMKMMYNFFLFEIK 427
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3236559
Number of Hits to DB: 506,711,245
Number of extensions: 8869076
Number of successful extensions: 24018
Number of sequences better than 10.0: 4
Number of HSP's gapped: 23944
Number of HSP's successfully gapped: 4
Length of query: 146
Length of database: 1,051,180,864
Length adjustment: 109
Effective length of query: 37
Effective length of database: 698,395,933
Effective search space: 25840649521
Effective search space used: 25840649521
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 29 (15.8 bits)
Dictyostelium discoideum cDNA Project Home