Homology Contig-U13721-1 vs Protein

Query= Contig-U13721-1 (Contig-U13721-1Q) /CSM_Contig/Contig-U13721-1Q.Seq.d
         (957 letters)

Database: nrp_B
           3,236,559 sequences; 1,051,180,864 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CP001176_1853(CP001176|pid:none) Bacillus cereus B4264, complete...    39   0.26
CP000001_1779(CP000001|pid:none) Bacillus cereus E33L, complete ...    39   0.26
AE017194_2053(AE017194|pid:none) Bacillus cereus ATCC 10987, com...    39   0.26
CP000133_3352(CP000133|pid:none) Rhizobium etli CFN 42, complete...    38   0.45
CP000227_1869(CP000227|pid:none) Bacillus cereus Q1, complete ge...    38   0.45
CP000853_2167(CP000853|pid:none) Alkaliphilus oremlandii OhILAs,...    37   1.0
CP000271_2150(CP000271|pid:none) Burkholderia xenovorans LB400 c...    35   3.8
CP000806_1021(CP000806|pid:none) Cyanothece sp. ATCC 51142 circu...    35   3.8
CP000473_5381(CP000473|pid:none) Solibacter usitatus Ellin6076, ...    28   3.9
AF003384_4(AF003384|pid:none) Caenorhabditis elegans cosmid K07B...    35   5.0
(Q10142) RecName: Full=Aureobasidin A resistance protein homolog...    34   6.5
EU851663_1(EU851663|pid:none) Hoplitis leucomelana long-waveleng...    34   8.5

>CP001176_1853(CP001176|pid:none) Bacillus cereus B4264, complete
           genome.
          Length = 205

 Score = 38.9 bits (89), Expect = 0.26
 Identities = 23/72 (31%), Positives = 42/72 (58%), Gaps = 2/72 (2%)
 Frame = +2

Query: 287 LSTEILQLSYI--SYYIWGYFMEIYILYNLWRCHLSKDPQQQKMMPIWDQRLKMFICSWI 460
           +S  +L  S++  S YI G+F  +Y+ + +WR + S D +Q+K MP+  Q L     S +
Sbjct: 62  VSLVLLTFSWLTNSLYIVGFFFLLYMGFVIWRSNPSNDVKQEKSMPLKKQILFAASVSLL 121

Query: 461 STYFIVFSINLI 496
           + + I+ +I +I
Sbjct: 122 NPHAILDTIGVI 133

Lambda     K      H
   0.318    0.134    0.401

Gapped
Lambda     K      H
   0.267   0.0410    0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3236559
Number of Hits to DB: 1,435,845,972
Number of extensions: 27612097
Number of successful extensions: 76878
Number of sequences better than 10.0: 12
Number of HSP's gapped: 76849
Number of HSP's successfully gapped: 13
Length of query: 319
Length of database: 1,051,180,864
Length adjustment: 128
Effective length of query: 191
Effective length of database: 636,901,312
Effective search space: 121648150592
Effective search space used: 121648150592
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)