Homology Contig-U12737-1 vs Protein

Query= Contig-U12737-1 (Contig-U12737-1Q) /CSM_Contig/Contig-U12737-1Q.Seq.d
         (1283 letters)

Database: nrp_B
           3,236,559 sequences; 1,051,180,864 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AL390189_15(AL390189|pid:none) Neurospora crassa DNA linkage gro...    92   4e-17
CU638743_492(CU638743|pid:none) Podospora anserina genomic DNA c...    89   3e-16
CR382129_625(CR382129|pid:none) Yarrowia lipolytica strain CLIB1...    89   4e-16
(P47104) RecName: Full=Regulator of V-ATPase in vacuolar membran...    87   1e-15
CU928181_125(CU928181|pid:none) Zygosaccharomyces rouxii strain ...    87   1e-15
AE016818_284(AE016818|pid:none) Ashbya gossypii (= Eremothecium ...    85   5e-15
AM270169_35(AM270169|pid:none) Aspergillus niger contig An08c014...    80   2e-13
AP007161_426(AP007161|pid:none) Aspergillus oryzae RIB40 genomic...    80   2e-13
(Q9Y817) RecName: Full=Putative regulator of V-ATPase in vacuola...    80   2e-13
CU928180_589(CU928180|pid:none) Kluyveromyces thermotolerans str...    79   3e-13
AP008207_1578(AP008207|pid:none) Oryza sativa (japonica cultivar...    77   2e-12
FN392320_364(FN392320|pid:none) Pichia pastoris GS115 chromosome...    76   2e-12
T13853(T13853) hypothetical protein X - fruit fly (Drosophila me...    76   3e-12
AC006418_10(AC006418|pid:none) Arabidopsis thaliana chromosome 2...    76   3e-12
AE014298_888(AE014298|pid:none) Drosophila melanogaster chromoso...    76   3e-12
BC127555_1(BC127555|pid:none) Xenopus tropicalis hypothetical pr...    74   9e-12
BC140781_1(BC140781|pid:none) Homo sapiens Dmx-like 2, mRNA (cDN...    74   1e-11
AB020663_1(AB020663|pid:none) Homo sapiens mRNA for KIAA0856 pro...    74   1e-11
(Q8TDJ6) RecName: Full=DmX-like protein 2; AltName: Full=Rabconn...    74   1e-11
T17121(T17121) CPY protein - midge (Chironomus thummi)  &X82317_...    70   1e-10
AK173043_1(AK173043|pid:none) Mus musculus premature mRNA for mK...    69   4e-10
(Q8BPN8) RecName: Full=DmX-like protein 2; AltName: Full=Rabconn...    69   4e-10
CT010507_4(CT010507|pid:none) Mouse DNA sequence from clone RP23...    69   4e-10
AB385168_1(AB385168|pid:none) Synthetic construct DNA, clone: pF...    66   3e-09
Z79639_3(Z79639|pid:none) Caenorhabditis elegans Cosmid F54E4, c...    64   1e-08
CR954207_205(CR954207|pid:none) Ostreococcus tauri strain OTTH05...    54   1e-05
CP001323_529(CP001323|pid:none) Micromonas sp. RCC299 chromosome...    50   1e-04
CR940352_445(CR940352|pid:none) Theileria annulata strain Ankara...    50   2e-04
AC099045_8(AC099045|pid:none) Trypanosoma brucei chromosome 8 cl...    50   2e-04
AL844507_40(AL844507|pid:none) Plasmodium falciparum 3D7 chromos...    44   0.013
BC112592_1(BC112592|pid:none) Bos taurus integrin beta 3 binding...    39   0.40
FM992690_54(FM992690|pid:none) Candida dubliniensis CD36 chromos...    39   0.53
AM910983_141(AM910983|pid:none) Plasmodium knowlesi strain H chr...    39   0.53
CT005246_40(CT005246|pid:none) Leishmania major strain Friedlin,...    35   4.5

>AL390189_15(AL390189|pid:none) Neurospora crassa DNA linkage group II
            BAC clone B13I18.
          Length = 1340

 Score = 92.0 bits (227), Expect = 4e-17
 Identities = 46/113 (40%), Positives = 71/113 (62%)
 Frame = +3

Query: 3    SQDFTQAKWITAANKSAFLLQSKHKYELAASLFLLAGQLKKAVNLLLQMQGDFQLALVIS 182
            + +F   KW TAA K+A+ L SK ++  AA+ FLLA  L+ AVN+ L    D QLA+ I+
Sbjct: 1084 ANNFDDPKWRTAALKNAYALMSKRRFAYAAAFFLLADHLQDAVNVCLNQLKDLQLAIAIT 1143

Query: 183  RLYEGENGECSRMIIEDHIIPLAKKTNDRSLLSICNWLLKKYEDAITCLIPSV 341
            R+YEG++G   R ++E+ ++P+A K  +R L S   W+L + + A+  LI  V
Sbjct: 1144 RVYEGDHGPVLRKLLEEEVLPIAAKDGNRWLASWAFWMLHRRDMAVRALITPV 1196

Lambda     K      H
   0.318    0.134    0.401

Gapped
Lambda     K      H
   0.267   0.0410    0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3236559
Number of Hits to DB: 1,608,394,553
Number of extensions: 28814227
Number of successful extensions: 71414
Number of sequences better than 10.0: 34
Number of HSP's gapped: 71374
Number of HSP's successfully gapped: 34
Length of query: 427
Length of database: 1,051,180,864
Length adjustment: 131
Effective length of query: 296
Effective length of database: 627,191,635
Effective search space: 185648723960
Effective search space used: 185648723960
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)