Homology Contig-U12710-1 vs Protein

Query= Contig-U12710-1 (Contig-U12710-1Q) /CSM_Contig/Contig-U12710-1Q.Seq.d
         (1548 letters)

Database: nrp_B
           3,236,559 sequences; 1,051,180,864 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY347747_1(AY347747|pid:none) Drosophila subobscura suppressor o...    62   4e-08
BC045871_1(BC045871|pid:none) Danio rerio cleavage stimulation f...    61   1e-07
AY576992_1(AY576992|pid:none) Danio rerio clone RK075A2H04 cleav...    61   1e-07
BC127520_1(BC127520|pid:none) Rattus norvegicus cleavage stimula...    60   2e-07
(Q7PLX1) RecName: Full=Protein suppressor of forked;                   60   2e-07
BC063376_1(BC063376|pid:none) Xenopus tropicalis cleavage stimul...    60   2e-07
AM071387_1(AM071387|pid:none) Xenopus laevis mRNA for cleavage s...    60   2e-07
BC077522_1(BC077522|pid:none) Xenopus laevis cleavage stimulatio...    60   2e-07
A46389(A46389;S22061) gene su(f) protein, 84K splice form - frui...    60   2e-07
AJ851400_1(AJ851400|pid:none) Gallus gallus mRNA for hypothetica...    59   4e-07
AK159180_1(AK159180|pid:none) Mus musculus osteoclast-like cell ...    59   4e-07
(Q99LI7) RecName: Full=Cleavage stimulation factor 77 kDa subuni...    59   4e-07
AB168614_1(AB168614|pid:none) Macaca fascicularis testis cDNA cl...    59   4e-07
AL121926_1(AL121926|pid:none) Human DNA sequence from clone RP1-...    59   4e-07
(Q5RDW9) RecName: Full=Cleavage stimulation factor 77 kDa subuni...    59   4e-07
AK297371_1(AK297371|pid:none) Homo sapiens cDNA FLJ58400 complet...    59   4e-07
U23830_1(U23830|pid:none) Caenorhabditis elegans suppressor of f...    59   5e-07
T21484(T21484) hypothetical protein F28C6.6 - Caenorhabditis ele...    59   5e-07
BT002320_1(BT002320|pid:none) Arabidopsis thaliana clone C105256...    58   1e-06
FN317398_1(FN317398|pid:none) Schistosoma japonicum isolate Anhu...    55   9e-06
(Q4PCV8) RecName: Full=mRNA 3'-end-processing protein RNA14;           40   0.30
CP000588_171(CP000588|pid:none) Ostreococcus lucimarinus CCE9901...    35   5.7
CP000716_879(CP000716|pid:none) Thermosipho melanesiensis BI429,...    35   7.5

>AY347747_1(AY347747|pid:none) Drosophila subobscura suppressor of
           forked (su(f)) gene, complete cds.
          Length = 732

 Score = 62.4 bits (150), Expect = 4e-08
 Identities = 38/110 (34%), Positives = 61/110 (55%), Gaps = 4/110 (3%)
 Frame = +1

Query: 1   RKFPSEIAFVNFYIEFXXXXXXXXXXRVLFEKLLTWPSLE--KSESIWRKFLDFEYRQNQ 174
           ++F     +V  YI++          RVLFE++L+   L   KS  +W +FL+FE
Sbjct: 439 KRFGGSPDYVMCYIDYLSHLNEDNNTRVLFERVLSSGGLSPHKSVEVWNRFLEFEANIG- 497

Query: 175 DVSSILKLEKRYQVTVNSNTDKSG--VLQALNRYKFLNLWSCHPTEIEII 318
           D+SSI+K+E+R      +  +  G    Q ++RYKFL+L+ C PTE++ I
Sbjct: 498 DLSSIVKVERRRSAVFENLKEYEGKETAQLVDRYKFLDLFPCTPTELKSI 547

Lambda     K      H
   0.316    0.134    0.394

Gapped
Lambda     K      H
   0.267   0.0410    0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3236559
Number of Hits to DB: 1,255,071,598
Number of extensions: 17067190
Number of successful extensions: 42962
Number of sequences better than 10.0: 23
Number of HSP's gapped: 42922
Number of HSP's successfully gapped: 24
Length of query: 516
Length of database: 1,051,180,864
Length adjustment: 133
Effective length of query: 383
Effective length of database: 620,718,517
Effective search space: 237735192011
Effective search space used: 237735192011
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 32 (16.9 bits)