Homology Contig-U12218-1 vs Protein

Query= Contig-U12218-1 (Contig-U12218-1Q) /CSM_Contig/Contig-U12218-1Q.Seq.d
         (1076 letters)

Database: nrp_B
           3,236,559 sequences; 1,051,180,864 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CT009609_17(CT009609|pid:none) Desulfococcus multivorans vrl isl...    92   2e-17
CP000527_534(CP000527|pid:none) Desulfovibrio vulgaris subsp. vu...    92   4e-17
AE017285_2761(AE017285|pid:none) Desulfovibrio vulgaris subsp. v...    92   4e-17
CP001337_2564(CP001337|pid:none) Chloroflexus aggregans DSM 9485...    90   1e-16
CP001087_2848(CP001087|pid:none) Desulfobacterium autotrophicum ...    89   3e-16
CP000702_1582(CP000702|pid:none) Thermotoga petrophila RKU-1, co...    87   1e-15
CP000916_1430(CP000916|pid:none) Thermotoga neapolitana DSM 4359...    85   5e-15
CP000141_173(CP000141|pid:none) Carboxydothermus hydrogenoforman...    85   5e-15
CP000804_3679(CP000804|pid:none) Roseiflexus castenholzii DSM 13...    83   1e-14
CP000969_1644(CP000969|pid:none) Thermotoga sp. RQ2, complete ge...    83   2e-14
CP000557_2671(CP000557|pid:none) Geobacillus thermodenitrificans...    81   7e-14
AP010904_2271(AP010904|pid:none) Desulfovibrio magneticus RS-1 D...    80   1e-13
CP000448_1048(CP000448|pid:none) Syntrophomonas wolfei subsp. wo...    80   2e-13
CP000909_3355(CP000909|pid:none) Chloroflexus aurantiacus J-10-f...    79   2e-13
CP000448_2479(CP000448|pid:none) Syntrophomonas wolfei subsp. wo...    79   2e-13
BA000004_3236(BA000004|pid:none) Bacillus halodurans C-125 DNA, ...    79   4e-13
CP000544_177(CP000544|pid:none) Halorhodospira halophila SL1, co...    79   4e-13
CP000821_3346(CP000821|pid:none) Shewanella sediminis HAW-EB3, c...    78   6e-13
AP009389_2126(AP009389|pid:none) Pelotomaculum thermopropionicum...    78   6e-13
CP000804_2776(CP000804|pid:none) Roseiflexus castenholzii DSM 13...    76   2e-12
CP001399_2524(CP001399|pid:none) Sulfolobus islandicus L.S.2.15,...    75   5e-12
CP000112_765(CP000112|pid:none) Desulfovibrio desulfuricans G20,...    74   9e-12
CP001146_767(CP001146|pid:none) Dictyoglomus thermophilum H-6-12...    74   1e-11
CP001404_134(CP001404|pid:none) Sulfolobus islandicus Y.N.15.51,...    74   1e-11
CP000930_2291(CP000930|pid:none) Heliobacterium modesticaldum Ic...    74   1e-11
CP000813_2576(CP000813|pid:none) Bacillus pumilus SAFR-032, comp...    73   1e-11
A72481(A72481)yhcV homolog APE2489 - Aeropyrum pernix (strain K1)      73   2e-11
CP000686_2428(CP000686|pid:none) Roseiflexus sp. RS-1, complete ...    73   2e-11
CP000020_1990(CP000020|pid:none) Vibrio fischeri ES114 chromosom...    72   3e-11
AE016877_4458(AE016877|pid:none) Bacillus cereus ATCC 14579, com...    72   3e-11
BA000023_1531(BA000023|pid:none) Sulfolobus tokodaii str. 7 DNA,...    72   3e-11
CP001322_279(CP001322|pid:none) Desulfatibacillum alkenivorans A...    72   3e-11
CP000804_3678(CP000804|pid:none) Roseiflexus castenholzii DSM 13...    72   3e-11
(P39066) RecName: Full=Acetoin utilization protein acuB;  &AF008...    72   3e-11
CP000968_251(CP000968|pid:none) Candidatus Korarchaeum cryptofil...    72   3e-11
CP000903_4383(CP000903|pid:none) Bacillus weihenstephanensis KBA...    72   4e-11
AE017194_4768(AE017194|pid:none) Bacillus cereus ATCC 10987, com...    72   4e-11
AE017355_4351(AE017355|pid:none) Bacillus thuringiensis serovar ...    72   4e-11
CP001322_3831(CP001322|pid:none) Desulfatibacillum alkenivorans ...    72   4e-11
CP000227_4377(CP000227|pid:none) Bacillus cereus Q1, complete ge...    72   4e-11
AE016879_4543(AE016879|pid:none) Bacillus anthracis str. Ames, c...    71   6e-11
CP001407_4591(CP001407|pid:none) Bacillus cereus 03BB102, comple...    71   6e-11
CP001336_4864(CP001336|pid:none) Desulfitobacterium hafniense DC...    71   6e-11
AP008230_5041(AP008230|pid:none) Desulfitobacterium hafniense Y5...    71   6e-11
AP008230_4291(AP008230|pid:none) Desulfitobacterium hafniense Y5...    70   1e-10
CP001336_1022(CP001336|pid:none) Desulfitobacterium hafniense DC...    70   1e-10
AE000666_640(AE000666|pid:none) Methanothermobacter thermautotro...    70   2e-10
AE017221_477(AE017221|pid:none) Thermus thermophilus HB27, compl...    70   2e-10
AP008226_829(AP008226|pid:none) Thermus thermophilus HB8 genomic...    70   2e-10
AC136449_13(AC136449|pid:none) Medicago truncatula clone mth2-11...    69   2e-10
CP001140_249(CP001140|pid:none) Desulfurococcus kamchatkensis 12...    69   2e-10
AJ248287_207(AJ248287|pid:none) Pyrococcus abyssi complete genom...    69   2e-10
CP000764_3177(CP000764|pid:none) Bacillus cereus subsp. cytotoxi...    69   2e-10
CP000509_962(CP000509|pid:none) Nocardioides sp. JS614, complete...    69   2e-10
CP000961_3485(CP000961|pid:none) Shewanella woodyi ATCC 51908, c...    69   2e-10
CP000922_460(CP000922|pid:none) Anoxybacillus flavithermus WK1, ...    69   3e-10
CT573071_1221(CT573071|pid:none) Kuenenia stuttgartiensis genome...    69   3e-10
CP000563_3153(CP000563|pid:none) Shewanella baltica OS155, compl...    69   3e-10
CP001389_2622(CP001389|pid:none) Rhizobium sp. NGR234, complete ...    69   3e-10
CP000686_882(CP000686|pid:none) Roseiflexus sp. RS-1, complete g...    69   4e-10
CP000968_1469(CP000968|pid:none) Candidatus Korarchaeum cryptofi...    69   4e-10
CP001055_578(CP001055|pid:none) Elusimicrobium minutum Pei191, c...    69   4e-10
BA000028_2222(BA000028|pid:none) Oceanobacillus iheyensis HTE831...    68   6e-10
AE006641_2501(AE006641|pid:none) Sulfolobus solfataricus P2, com...    67   8e-10
CP000302_1948(CP000302|pid:none) Shewanella denitrificans OS217,...    67   8e-10
AE017285_1842(AE017285|pid:none) Desulfovibrio vulgaris subsp. v...    67   1e-09
CP000478_3917(CP000478|pid:none) Syntrophobacter fumaroxidans MP...    67   1e-09
CP000738_2966(CP000738|pid:none) Sinorhizobium medicae WSM419, c...    67   1e-09
CP000478_2055(CP000478|pid:none) Syntrophobacter fumaroxidans MP...    67   1e-09
AE000666_1202(AE000666|pid:none) Methanothermobacter thermautotr...    67   1e-09
AM743169_1056(AM743169|pid:none) Stenotrophomonas maltophilia K2...    66   2e-09
BX950229_1359(BX950229|pid:none) Methanococcus maripaludis strai...    66   2e-09
BA000002_163(BA000002|pid:none) Aeropyrum pernix K1 DNA, complet...    66   2e-09
CP000743_783(CP000743|pid:none) Methanococcus aeolicus Nankai-3,...    66   2e-09
CP001358_1515(CP001358|pid:none) Desulfovibrio desulfuricans sub...    66   2e-09
CP001322_3773(CP001322|pid:none) Desulfatibacillum alkenivorans ...    66   2e-09
(Q59011) RecName: Full=Inosine-5'-monophosphate dehydrogenase;  ...    66   2e-09
CP000769_2418(CP000769|pid:none) Anaeromyxobacter sp. Fw109-5, c...    66   2e-09
CP000469_1049(CP000469|pid:none) Shewanella sp. ANA-3, complete ...    65   3e-09
AE009439_907(AE009439|pid:none) Methanopyrus kandleri AV19, comp...    65   3e-09
CP000387_1636(CP000387|pid:none) Streptococcus sanguinis SK36, c...    65   3e-09
CP000155_211(CP000155|pid:none) Hahella chejuensis KCTC 2396, co...    65   3e-09
CP000312_498(CP000312|pid:none) Clostridium perfringens SM101, c...    65   3e-09
CP000867_1301(CP000867|pid:none) Methanococcus maripaludis C6, c...    65   3e-09
CP000115_1017(CP000115|pid:none) Nitrobacter winogradskyi Nb-255...    65   3e-09
CP000961_686(CP000961|pid:none) Shewanella woodyi ATCC 51908, co...    65   3e-09
CP000721_2076(CP000721|pid:none) Clostridium beijerinckii NCIMB ...    65   3e-09
CP000859_2973(CP000859|pid:none) Desulfococcus oleovorans Hxd3, ...    65   3e-09
CP000682_835(CP000682|pid:none) Metallosphaera sedula DSM 5348, ...    65   3e-09
CP000159_534(CP000159|pid:none) Salinibacter ruber DSM 13855, co...    65   3e-09
CP001287_3794(CP001287|pid:none) Cyanothece sp. PCC 8801, comple...    65   3e-09
AE006469_335(AE006469|pid:none) Sinorhizobium meliloti 1021 plas...    65   4e-09
BA000002_684(BA000002|pid:none) Aeropyrum pernix K1 DNA, complet...    65   4e-09
CP000077_1113(CP000077|pid:none) Sulfolobus acidocaldarius DSM 6...    65   4e-09
(Q57564) RecName: Full=Uncharacterized protein MJ0100;  &D64312(...    65   4e-09
CR378666_233(CR378666|pid:none) Photobacterium profundum SS9; se...    65   4e-09
CP000749_3948(CP000749|pid:none) Marinomonas sp. MWYL1, complete...    65   4e-09
CP000855_1892(CP000855|pid:none) Thermococcus onnurineus NA1, co...    65   4e-09
CP000444_1113(CP000444|pid:none) Shewanella sp. MR-7, complete g...    65   4e-09
CP000817_4013(CP000817|pid:none) Lysinibacillus sphaericus C3-41...    65   4e-09
CR954211_13(CR954211|pid:none) Ostreococcus tauri strain OTTH059...    65   4e-09
F72694(F72694)hypothetical protein APE0974 - Aeropyrum pernix (s...    65   4e-09
CP000446_1053(CP000446|pid:none) Shewanella sp. MR-4, complete g...    65   4e-09
CP001349_5935(CP001349|pid:none) Methylobacterium nodulans ORS 2...    65   5e-09
CP000246_516(CP000246|pid:none) Clostridium perfringens ATCC 131...    65   5e-09
EU959640_1(EU959640|pid:none) Zea mays clone 219007 IMP dehydrog...    65   5e-09
BT084954_1(BT084954|pid:none) Zea mays full-length cDNA clone ZM...    65   5e-09
CP001197_408(CP001197|pid:none) Desulfovibrio vulgaris str. 'Miy...    64   7e-09
CP001291_4809(CP001291|pid:none) Cyanothece sp. PCC 7424, comple...    64   7e-09
CP000789_975(CP000789|pid:none) Vibrio harveyi ATCC BAA-1116 chr...    64   7e-09
CP000077_274(CP000077|pid:none) Sulfolobus acidocaldarius DSM 63...    64   9e-09
CP000941_698(CP000941|pid:none) Xylella fastidiosa M12, complete...    64   9e-09
CP000477_294(CP000477|pid:none) Methanosaeta thermophila PT, com...    64   9e-09
AE003849_1409(AE003849|pid:none) Xylella fastidiosa 9a5c, comple...    64   9e-09
CP000453_2655(CP000453|pid:none) Alkalilimnicola ehrlichii MLHE-...    64   9e-09
CP001111_959(CP001111|pid:none) Stenotrophomonas maltophilia R55...    64   9e-09
AE009442_605(AE009442|pid:none) Xylella fastidiosa Temecula1, co...    64   9e-09
CP001089_2504(CP001089|pid:none) Geobacter lovleyi SZ, complete ...    64   9e-09
(Q58629) RecName: Full=Uncharacterized protein MJ1232;  &G64453(...    64   9e-09
AE014299_1218(AE014299|pid:none) Shewanella oneidensis MR-1, com...    64   9e-09
(Q58622) RecName: Full=Uncharacterized protein MJ1225;  &H64452(...    64   9e-09
CP000493_1101(CP000493|pid:none) Hyperthermus butylicus DSM 5456...    64   1e-08
AL161590_17(AL161590|pid:none) Arabidopsis thaliana DNA chromoso...    64   1e-08
CP001185_891(CP001185|pid:none) Thermosipho africanus TCF52B, co...    64   1e-08
CP000867_1629(CP000867|pid:none) Methanococcus maripaludis C6, c...    63   2e-08
AL766852_70(AL766852|pid:none) Streptococcus agalactiae NEM316 c...    63   2e-08
CP000744_3402(CP000744|pid:none) Pseudomonas aeruginosa PA7, com...    63   2e-08
AE004091_1856(AE004091|pid:none) Pseudomonas aeruginosa PAO1, co...    63   2e-08
CP000477_19(CP000477|pid:none) Methanosaeta thermophila PT, comp...    63   2e-08
CP000562_1511(CP000562|pid:none) Methanoculleus marisnigri JR1, ...    63   2e-08
CP000644_3278(CP000644|pid:none) Aeromonas salmonicida subsp. sa...    63   2e-08
CP000629_460(CP000629|pid:none) Agrobacterium radiobacter K84 ch...    63   2e-08
AE000666_123(AE000666|pid:none) Methanothermobacter thermautotro...    63   2e-08
CP000606_2787(CP000606|pid:none) Shewanella loihica PV-4, comple...    63   2e-08
CP000931_2544(CP000931|pid:none) Shewanella halifaxensis HAW-EB4...    62   3e-08
CP000438_3232(CP000438|pid:none) Pseudomonas aeruginosa UCBPP-PA...    62   3e-08
CP000407_647(CP000407|pid:none) Streptococcus suis 05ZYH33, comp...    62   3e-08
BA000031_585(BA000031|pid:none) Vibrio parahaemolyticus RIMD 221...    62   3e-08
AK121969_1(AK121969|pid:none) Oryza sativa Japonica Group cDNA c...    62   3e-08
AY360386_16(AY360386|pid:none) Oryza sativa (japonica cultivar-g...    62   3e-08
A69398(A69398) MJ0100 protein homolog AF1186 - Archaeoglobus ful...    62   3e-08
CP000359_710(CP000359|pid:none) Deinococcus geothermalis DSM 113...    62   3e-08
CP000930_1665(CP000930|pid:none) Heliobacterium modesticaldum Ic...    62   3e-08
AE016795_426(AE016795|pid:none) Vibrio vulnificus CMCP6 chromoso...    62   3e-08
FM178379_2436(FM178379|pid:none) Aliivibrio salmonicida LFI1238 ...    62   3e-08
CP000816_596(CP000816|pid:none) Ignicoccus hospitalis KIN4/I, co...    62   3e-08
CP000742_339(CP000742|pid:none) Methanococcus vannielii SB, comp...    62   3e-08
CP000462_1687(CP000462|pid:none) Aeromonas hydrophila subsp. hyd...    62   3e-08
BA000037_743(BA000037|pid:none) Vibrio vulnificus YJ016 DNA, chr...    62   3e-08
CP000930_1651(CP000930|pid:none) Heliobacterium modesticaldum Ic...    62   3e-08
AM778937_19(AM778937|pid:none) Microcystis aeruginosa PCC 7806 g...    62   3e-08
CP000559_1370(CP000559|pid:none) Methanocorpusculum labreanum Z,...    62   5e-08
AE007317_664(AE007317|pid:none) Streptococcus pneumoniae R6, com...    62   5e-08
CP000102_1379(CP000102|pid:none) Methanosphaera stadtmanae DSM 3...    62   5e-08
A72328(A72328) conserved hypothetical protein - Thermotoga marit...    62   5e-08
CP000702_98(CP000702|pid:none) Thermotoga petrophila RKU-1, comp...    62   5e-08
CP001196_2783(CP001196|pid:none) Oligotropha carboxidovorans OM5...    62   5e-08
AP009552_1852(AP009552|pid:none) Microcystis aeruginosa NIES-843...    62   5e-08
CP000478_2180(CP000478|pid:none) Syntrophobacter fumaroxidans MP...    62   5e-08
AE015927_271(AE015927|pid:none) Clostridium tetani E88, complete...    61   6e-08
AE001437_968(AE001437|pid:none) Clostridium acetobutylicum ATCC ...    61   6e-08
(Q9UY49) RecName: Full=Inosine-5'-monophosphate dehydrogenase;  ...    61   6e-08
BX950229_908(BX950229|pid:none) Methanococcus maripaludis strain...    61   6e-08
BA000023_2276(BA000023|pid:none) Sulfolobus tokodaii str. 7 DNA,...    61   8e-08
CP000725_1580(CP000725|pid:none) Streptococcus gordonii str. Cha...    61   8e-08
CP000448_1822(CP000448|pid:none) Syntrophomonas wolfei subsp. wo...    61   8e-08
AE001437_2806(AE001437|pid:none) Clostridium acetobutylicum ATCC...    61   8e-08
CP000968_1467(CP000968|pid:none) Candidatus Korarchaeum cryptofi...    61   8e-08
CP000828_6253(CP000828|pid:none) Acaryochloris marina MBIC11017,...    61   8e-08
CP000148_1861(CP000148|pid:none) Geobacter metallireducens GS-15...    60   1e-07
CP000860_256(CP000860|pid:none) Candidatus Desulforudis audaxvia...    60   1e-07
AK061717_1(AK061717|pid:none) Oryza sativa Japonica Group cDNA c...    60   1e-07
CP000560_2592(CP000560|pid:none) Bacillus amyloliquefaciens FZB4...    60   1e-07
AE000513_972(AE000513|pid:none) Deinococcus radiodurans R1 chrom...    60   1e-07
X53676_10(X53676|pid:none) Pseudomonas stutzeri, complete denitr...    60   1e-07
AE000782_1242(AE000782|pid:none) Archaeoglobus fulgidus DSM 4304...    60   1e-07
CP000304_3460(CP000304|pid:none) Pseudomonas stutzeri A1501, com...    60   1e-07
CP001087_2674(CP001087|pid:none) Desulfobacterium autotrophicum ...    60   1e-07
CP000568_677(CP000568|pid:none) Clostridium thermocellum ATCC 27...    60   1e-07
AM236080_856(AM236080|pid:none) Rhizobium leguminosarum bv. vici...    60   1e-07
CP001034_304(CP001034|pid:none) Natranaerobius thermophilus JW/N...    60   1e-07
(O58045) RecName: Full=Inosine-5'-monophosphate dehydrogenase;  ...    60   1e-07
CP000777_1048(CP000777|pid:none) Leptospira biflexa serovar Pato...    60   1e-07
CP000745_152(CP000745|pid:none) Methanococcus maripaludis C7, co...    60   1e-07
CP001053_1526(CP001053|pid:none) Burkholderia phytofirmans PsJN ...    60   1e-07
CR522870_2830(CR522870|pid:none) Desulfotalea psychrophila LSv54...    60   1e-07
CP000806_4162(CP000806|pid:none) Cyanothece sp. ATCC 51142 circu...    60   1e-07
CP000918_755(CP000918|pid:none) Streptococcus pneumoniae 70585, ...    60   1e-07
CP001114_1070(CP001114|pid:none) Deinococcus deserti VCD115, com...    60   1e-07
AM236083_7(AM236083|pid:none) Rhizobium leguminosarum bv. viciae...    60   1e-07
CP000102_654(CP000102|pid:none) Methanosphaera stadtmanae DSM 30...    60   2e-07
AP008231_2270(AP008231|pid:none) Synechococcus elongatus PCC 630...    60   2e-07
AP006627_2753(AP006627|pid:none) Bacillus clausii KSM-K16 DNA, c...    60   2e-07
CP001399_2149(CP001399|pid:none) Sulfolobus islandicus L.S.2.15,...    60   2e-07
AY714817_10(AY714817|pid:none) Uncultured archaeon GZfos12E1 clo...    59   2e-07
CP000919_651(CP000919|pid:none) Streptococcus pneumoniae JJA, co...    59   2e-07
FM211187_656(FM211187|pid:none) Streptococcus pneumoniae ATCC 70...    59   2e-07
AM114193_1676(AM114193|pid:none) Uncultured methanogenic archaeo...    59   2e-07
CP000609_708(CP000609|pid:none) Methanococcus maripaludis C5, co...    59   2e-07
CP000644_2433(CP000644|pid:none) Aeromonas salmonicida subsp. sa...    59   2e-07
EU158805_33(EU158805|pid:none) Streptomyces cacaoi subsp. asoens...    59   2e-07
AE008923_2920(AE008923|pid:none) Xanthomonas axonopodis pv. citr...    59   2e-07
CP000142_1450(CP000142|pid:none) Pelobacter carbinolicus DSM 238...    59   2e-07
AL445065_156(AL445065|pid:none) Thermoplasma acidophilum complet...    59   2e-07
CP000698_2281(CP000698|pid:none) Geobacter uraniireducens Rf4, c...    59   3e-07
AE009439_89(AE009439|pid:none) Methanopyrus kandleri AV19, compl...    59   3e-07
CP001399_2130(CP001399|pid:none) Sulfolobus islandicus L.S.2.15,...    59   3e-07
CP000967_3839(CP000967|pid:none) Xanthomonas oryzae pv. oryzae P...    59   3e-07
CP000142_1101(CP000142|pid:none) Pelobacter carbinolicus DSM 238...    59   3e-07
CP000634_638(CP000634|pid:none) Agrobacterium vitis S4 chromosom...    59   3e-07
AE006641_2953(AE006641|pid:none) Sulfolobus solfataricus P2, com...    59   3e-07
AE013598_1269(AE013598|pid:none) Xanthomonas oryzae pv. oryzae K...    59   3e-07
CP000867_1732(CP000867|pid:none) Methanococcus maripaludis C6, c...    59   3e-07
AP006841_4068(AP006841|pid:none) Bacteroides fragilis YCH46 DNA,...    59   3e-07
AP010904_1708(AP010904|pid:none) Desulfovibrio magneticus RS-1 D...    59   3e-07
CP001338_2519(CP001338|pid:none) Candidatus Methanosphaerula pal...    59   4e-07
AY714858_32(AY714858|pid:none) Uncultured archaeon GZfos33H6 clo...    59   4e-07
CP001400_2002(CP001400|pid:none) Sulfolobus islandicus M.14.25, ...    59   4e-07
CP000493_111(CP000493|pid:none) Hyperthermus butylicus DSM 5456,...    59   4e-07
CP001251_1430(CP001251|pid:none) Dictyoglomus turgidum DSM 6724,...    59   4e-07
AP009049_2488(AP009049|pid:none) Clostridium kluyveri NBRC 12016...    59   4e-07
CP000673_2745(CP000673|pid:none) Clostridium kluyveri DSM 555, c...    59   4e-07
AP010904_910(AP010904|pid:none) Desulfovibrio magneticus RS-1 DN...    58   5e-07
CP001400_1983(CP001400|pid:none) Sulfolobus islandicus M.14.25, ...    58   5e-07
AP009484_1413(AP009484|pid:none) Macrococcus caseolyticus JCSC54...    58   5e-07
CP000951_339(CP000951|pid:none) Synechococcus sp. PCC 7002, comp...    58   7e-07
CP000472_1883(CP000472|pid:none) Shewanella piezotolerans WP3, c...    58   7e-07
CP000471_1032(CP000471|pid:none) Magnetococcus sp. MC-1, complet...    58   7e-07
CU633749_633(CU633749|pid:none) Cupriavidus taiwanensis str. LMG...    58   7e-07
CP000133_778(CP000133|pid:none) Rhizobium etli CFN 42, complete ...    58   7e-07
EU955423_1(EU955423|pid:none) Zea mays clone 1531721 cystathioni...    58   7e-07
CP001087_4779(CP001087|pid:none) Desulfobacterium autotrophicum ...    58   7e-07
CP000141_374(CP000141|pid:none) Carboxydothermus hydrogenoforman...    58   7e-07
CR954246_561(CR954246|pid:none) Pseudoalteromonas haloplanktis s...    58   7e-07
CP000559_447(CP000559|pid:none) Methanocorpusculum labreanum Z, ...    58   7e-07
AY714817_11(AY714817|pid:none) Uncultured archaeon GZfos12E1 clo...    57   9e-07
AE006469_592(AE006469|pid:none) Sinorhizobium meliloti 1021 plas...    57   9e-07
CP001349_2261(CP001349|pid:none) Methylobacterium nodulans ORS 2...    57   9e-07
CP000922_2307(CP000922|pid:none) Anoxybacillus flavithermus WK1,...    57   9e-07
CP000477_478(CP000477|pid:none) Methanosaeta thermophila PT, com...    57   9e-07
CP000869_959(CP000869|pid:none) Burkholderia multivorans ATCC 17...    57   9e-07
AP009386_1189(AP009386|pid:none) Burkholderia multivorans ATCC 1...    57   9e-07
AL009126_1551(AL009126|pid:none) Bacillus subtilis subsp. subtil...    57   9e-07
CP000561_1672(CP000561|pid:none) Pyrobaculum calidifontis JCM 11...    57   9e-07
CU234118_5020(CU234118|pid:none) Bradyrhizobium sp. ORS278,compl...    57   9e-07
AE006641_2975(AE006641|pid:none) Sulfolobus solfataricus P2, com...    57   9e-07
CP001130_189(CP001130|pid:none) Hydrogenobaculum sp. Y04AAS1, co...    57   9e-07
CP000769_2929(CP000769|pid:none) Anaeromyxobacter sp. Fw109-5, c...    57   9e-07
AY714864_13(AY714864|pid:none) Uncultured archaeon GZfos35B7 clo...    57   9e-07
G69873(G69873) yhcV-related protein ylbB - Bacillus subtilis  &Z...    57   9e-07
CP000769_1437(CP000769|pid:none) Anaeromyxobacter sp. Fw109-5, c...    57   1e-06
AE008384_1305(AE008384|pid:none) Methanosarcina mazei strain Goe...    57   1e-06
AY714837_4(AY714837|pid:none) Uncultured archaeon GZfos24D9 clon...    57   1e-06
CP000609_338(CP000609|pid:none) Methanococcus maripaludis C5, co...    57   1e-06
CP001098_1876(CP001098|pid:none) Halothermothrix orenii H 168, c...    57   1e-06
CP000379_838(CP000379|pid:none) Burkholderia cenocepacia AU 1054...    57   1e-06
AE005672_711(AE005672|pid:none) Streptococcus pneumoniae TIGR4, ...    57   1e-06
CP000463_1716(CP000463|pid:none) Rhodopseudomonas palustris BisA...    57   1e-06
CP000482_2226(CP000482|pid:none) Pelobacter propionicus DSM 2379...    57   1e-06
BA000023_885(BA000023|pid:none) Sulfolobus tokodaii str. 7 DNA, ...    57   1e-06
CU914168_188(CU914168|pid:none) Ralstonia solanacearum strain IP...    57   1e-06
AE009439_869(AE009439|pid:none) Methanopyrus kandleri AV19, comp...    57   1e-06
CP000742_168(CP000742|pid:none) Methanococcus vannielii SB, comp...    57   1e-06
AE017221_1103(AE017221|pid:none) Thermus thermophilus HB27, comp...    57   1e-06
CP000300_289(CP000300|pid:none) Methanococcoides burtonii DSM 62...    57   1e-06
AL939104_199(AL939104|pid:none) Streptomyces coelicolor A3(2) co...    57   1e-06
AP010904_1380(AP010904|pid:none) Desulfovibrio magneticus RS-1 D...    57   1e-06
CP001022_2203(CP001022|pid:none) Exiguobacterium sibiricum 255-1...    56   2e-06
CP000151_2927(CP000151|pid:none) Burkholderia sp. 383 chromosome...    56   2e-06
CP000141_1896(CP000141|pid:none) Carboxydothermus hydrogenoforma...    56   2e-06
AM778953_106(AM778953|pid:none) Microcystis aeruginosa PCC 7806 ...    56   2e-06
AE002098_332(AE002098|pid:none) Neisseria meningitidis MC58, com...    56   2e-06
CP001230_45(CP001230|pid:none) Persephonella marina EX-H1, compl...    56   2e-06
AL157959_1903(AL157959|pid:none) Neisseria meningitidis serogrou...    56   2e-06
AE010299_1773(AE010299|pid:none) Methanosarcina acetivorans str....    56   2e-06
AM421808_1661(AM421808|pid:none) Neisseria meningitidis serogrou...    56   2e-06
CP000319_1818(CP000319|pid:none) Nitrobacter hamburgensis X14, c...    56   2e-06
AM747721_1727(AM747721|pid:none) Burkholderia cenocepacia J2315 ...    56   2e-06
CP001291_2335(CP001291|pid:none) Cyanothece sp. PCC 7424, comple...    56   2e-06
CP000381_1706(CP000381|pid:none) Neisseria meningitidis 053442, ...    56   2e-06
CP000378_2157(CP000378|pid:none) Burkholderia cenocepacia AU 105...    56   2e-06
AE017340_1173(AE017340|pid:none) Idiomarina loihiensis L2TR, com...    56   2e-06
CP000507_2915(CP000507|pid:none) Shewanella amazonensis SB2B, co...    56   2e-06
AE000666_1255(AE000666|pid:none) Methanothermobacter thermautotr...    56   2e-06
CP001338_1963(CP001338|pid:none) Candidatus Methanosphaerula pal...    56   2e-06
CP000099_946(CP000099|pid:none) Methanosarcina barkeri str. Fusa...    56   2e-06
AM746676_3471(AM746676|pid:none) Sorangium cellulosum 'So ce 56'...    56   2e-06
BA000011_811(BA000011|pid:none) Thermoplasma volcanium GSS1 DNA,...    55   3e-06
CP001389_369(CP001389|pid:none) Rhizobium sp. NGR234, complete g...    55   3e-06
BX572606_235(BX572606|pid:none) Rhodopseudomonas palustris CGA00...    55   3e-06
CP000239_1770(CP000239|pid:none) Synechococcus sp. JA-3-3Ab, com...    55   3e-06
CP000609_1376(CP000609|pid:none) Methanococcus maripaludis C5, c...    55   3e-06
CP000959_2544(CP000959|pid:none) Burkholderia cenocepacia MC0-3 ...    55   3e-06
CR555306_1761(CR555306|pid:none) Azoarcus sp. EbN1 complete geno...    55   3e-06
CP001189_2158(CP001189|pid:none) Gluconacetobacter diazotrophicu...    55   3e-06
CP000390_3851(CP000390|pid:none) Mesorhizobium sp. BNC1, complet...    55   3e-06
CP001614_2265(CP001614|pid:none) Teredinibacter turnerae T7901, ...    55   3e-06
AP009153_1644(AP009153|pid:none) Gemmatimonas aurantiaca T-27 DN...    55   3e-06
CP001398_760(CP001398|pid:none) Thermococcus gammatolerans EJ3, ...    55   3e-06
CP001197_273(CP001197|pid:none) Desulfovibrio vulgaris str. 'Miy...    55   3e-06
AP006618_4317(AP006618|pid:none) Nocardia farcinica IFM 10152 DN...    55   4e-06
CP000606_2362(CP000606|pid:none) Shewanella loihica PV-4, comple...    55   4e-06
CP001338_1108(CP001338|pid:none) Candidatus Methanosphaerula pal...    55   4e-06
CP001124_1248(CP001124|pid:none) Geobacter bemidjiensis Bem, com...    55   4e-06
CP000152_1301(CP000152|pid:none) Burkholderia sp. 383 chromosome...    55   4e-06
CP000721_1925(CP000721|pid:none) Clostridium beijerinckii NCIMB ...    55   4e-06
CP001132_1557(CP001132|pid:none) Acidithiobacillus ferrooxidans ...    55   4e-06
CP000388_2504(CP000388|pid:none) Pseudoalteromonas atlantica T6c...    55   4e-06
AL591688_762(AL591688|pid:none) Sinorhizobium meliloti 1021 comp...    55   4e-06
CP000866_669(CP000866|pid:none) Nitrosopumilus maritimus SCM1, c...    55   6e-06
CP000852_1093(CP000852|pid:none) Caldivirga maquilingensis IC-16...    55   6e-06
AE015451_4412(AE015451|pid:none) Pseudomonas putida KT2440 compl...    55   6e-06
CP000709_280(CP000709|pid:none) Brucella ovis ATCC 25840 chromos...    55   6e-06
(Q5SMG8) RecName: Full=Magnesium transporter mgtE;  &AP008226_10...    55   6e-06
(Q58332) RecName: Full=Uncharacterized protein MJ0922;  &B64415(...    55   6e-06
DQ212709_1(DQ212709|pid:none) Gallus gallus 5'-AMP-activated pro...    55   6e-06
CP001131_2511(CP001131|pid:none) Anaeromyxobacter sp. K, complet...    55   6e-06
AM260479_682(AM260479|pid:none) Ralstonia eutropha H16 chromosom...    55   6e-06
AP010904_209(AP010904|pid:none) Desulfovibrio magneticus RS-1 DN...    55   6e-06
CP000742_13(CP000742|pid:none) Methanococcus vannielii SB, compl...    55   6e-06
AJ720277_1(AJ720277|pid:none) Gallus gallus mRNA for hypothetica...    55   6e-06
DQ212708_1(DQ212708|pid:none) Gallus gallus 5'-AMP-activated pro...    55   6e-06
CP000251_1326(CP000251|pid:none) Anaeromyxobacter dehalogenans 2...    55   6e-06
CP000159_1562(CP000159|pid:none) Salinibacter ruber DSM 13855, c...    55   6e-06
CP000682_239(CP000682|pid:none) Metallosphaera sedula DSM 5348, ...    55   6e-06
CP000926_3950(CP000926|pid:none) Pseudomonas putida GB-1, comple...    55   6e-06
AE008384_1301(AE008384|pid:none) Methanosarcina mazei strain Goe...    55   6e-06
AP009256_450(AP009256|pid:none) Bifidobacterium adolescentis ATC...    54   7e-06
AL954747_524(AL954747|pid:none) Nitrosomonas europaea ATCC 19718...    54   7e-06
AL939104_159(AL939104|pid:none) Streptomyces coelicolor A3(2) co...    54   7e-06
CP000738_376(CP000738|pid:none) Sinorhizobium medicae WSM419, co...    54   7e-06
CP000450_961(CP000450|pid:none) Nitrosomonas eutropha C91, compl...    54   7e-06
CP000077_1123(CP000077|pid:none) Sulfolobus acidocaldarius DSM 6...    54   7e-06
CP000254_2817(CP000254|pid:none) Methanospirillum hungatei JF-1,...    54   7e-06
BA000040_6074(BA000040|pid:none) Bradyrhizobium japonicum USDA 1...    54   7e-06
BA000043_569(BA000043|pid:none) Geobacillus kaustophilus HTA426 ...    54   7e-06
CP000774_1166(CP000774|pid:none) Parvibaculum lavamentivorans DS...    54   7e-06
CP000361_998(CP000361|pid:none) Arcobacter butzleri RM4018, comp...    54   7e-06
CP000304_1360(CP000304|pid:none) Pseudomonas stutzeri A1501, com...    54   7e-06
CP000612_441(CP000612|pid:none) Desulfotomaculum reducens MI-1, ...    54   7e-06
AE017180_1998(AE017180|pid:none) Geobacter sulfurreducens PCA, c...    54   7e-06
AM412317_197(AM412317|pid:none) Clostridium botulinum A str. ATC...    54   9e-06
CP000494_643(CP000494|pid:none) Bradyrhizobium sp. BTAi1, comple...    54   9e-06
CP000821_1749(CP000821|pid:none) Shewanella sediminis HAW-EB3, c...    54   9e-06
CP000474_2743(CP000474|pid:none) Arthrobacter aurescens TC1, com...    54   9e-06
AE017282_2277(AE017282|pid:none) Methylococcus capsulatus str. B...    54   9e-06
CP000943_3389(CP000943|pid:none) Methylobacterium sp. 4-46, comp...    54   9e-06
AP009049_3170(AP009049|pid:none) Clostridium kluyveri NBRC 12016...    54   9e-06
CP001034_2779(CP001034|pid:none) Natranaerobius thermophilus JW/...    54   9e-06
CP000416_284(CP000416|pid:none) Lactobacillus brevis ATCC 367, c...    54   9e-06
CP000686_1841(CP000686|pid:none) Roseiflexus sp. RS-1, complete ...    54   9e-06
CP001055_281(CP001055|pid:none) Elusimicrobium minutum Pei191, c...    54   9e-06
CP000493_1104(CP000493|pid:none) Hyperthermus butylicus DSM 5456...    54   9e-06
CP001615_693(CP001615|pid:none) Exiguobacterium sp. AT1b, comple...    54   9e-06
AE008922_2750(AE008922|pid:none) Xanthomonas campestris pv. camp...    54   9e-06
CP000769_358(CP000769|pid:none) Anaeromyxobacter sp. Fw109-5, co...    54   1e-05
CP000136_107(CP000136|pid:none) Rhizobium etli CFN 42 plasmid p4...    54   1e-05
AE009439_526(AE009439|pid:none) Methanopyrus kandleri AV19, comp...    54   1e-05
CP000254_2125(CP000254|pid:none) Methanospirillum hungatei JF-1,...    54   1e-05
CP001230_222(CP001230|pid:none) Persephonella marina EX-H1, comp...    54   1e-05
(Q91WG5) RecName: Full=5'-AMP-activated protein kinase subunit g...    54   1e-05
CP000742_1388(CP000742|pid:none) Methanococcus vannielii SB, com...    54   1e-05
BT008166_1(BT008166|pid:none) Synthetic construct Homo sapiens p...    54   1e-05
AM114193_1197(AM114193|pid:none) Uncultured methanogenic archaeo...    54   1e-05
CP001359_3363(CP001359|pid:none) Anaeromyxobacter dehalogenans 2...    54   1e-05
CP000662_451(CP000662|pid:none) Rhodobacter sphaeroides ATCC 170...    54   1e-05
AF087875_1(AF087875|pid:none) Homo sapiens AMP-activated protein...    54   1e-05
BC097267_1(BC097267|pid:none) Rattus norvegicus protein kinase, ...    54   1e-05
AB025580_1(AB025580|pid:none) Homo sapiens mRNA for H91620p, com...    54   1e-05
CP000924_670(CP000924|pid:none) Thermoanaerobacter pseudethanoli...    54   1e-05
CP000860_1145(CP000860|pid:none) Candidatus Desulforudis audaxvi...    54   1e-05
AK154296_1(AK154296|pid:none) Mus musculus NOD-derived CD11c +ve...    54   1e-05
AK165834_1(AK165834|pid:none) Mus musculus lung RCB-0558 LLC cDN...    54   1e-05
AY348864_1(AY348864|pid:none) Mus musculus AMP-activated protein...    54   1e-05
AP009179_1794(AP009179|pid:none) Sulfurovum sp. NBC37-1 genomic ...    54   1e-05
AE017221_695(AE017221|pid:none) Thermus thermophilus HB27, compl...    54   1e-05
CP000614_2854(CP000614|pid:none) Burkholderia vietnamiensis G4 c...    54   1e-05
(Q9UGJ0) RecName: Full=5'-AMP-activated protein kinase subunit g...    54   1e-05
AY376854_1(AY376854|pid:none) Rattus norvegicus adenosine monoph...    54   1e-05
CP000571_1478(CP000571|pid:none) Burkholderia pseudomallei 668 c...    54   1e-05
CP000923_1161(CP000923|pid:none) Thermoanaerobacter sp. X514, co...    54   1e-05
AE010300_297(AE010300|pid:none) Leptospira interrogans serovar l...    54   1e-05
(P65167) RecName: Full=Inosine-5'-monophosphate dehydrogenase;  ...    54   1e-05
AK301123_1(AK301123|pid:none) Homo sapiens cDNA FLJ54740 complet...    54   1e-05
AY348865_1(AY348865|pid:none) Rattus norvegicus AMP-activated pr...    54   1e-05
CP000780_1266(CP000780|pid:none) Candidatus Methanoregula boonei...    54   1e-05
AE010299_4527(AE010299|pid:none) Methanosarcina acetivorans str....    54   1e-05
CP000554_1736(CP000554|pid:none) Prochlorococcus marinus str. MI...    54   1e-05
BC020540_1(BC020540|pid:none) Homo sapiens protein kinase, AMP-a...    54   1e-05
BX571966_1032(BX571966|pid:none) Burkholderia pseudomallei strai...    54   1e-05
CP000011_1145(CP000011|pid:none) Burkholderia mallei ATCC 23344 ...    54   1e-05
BC115291_1(BC115291|pid:none) Danio rerio zgc:136850, mRNA (cDNA...    54   1e-05
AK032238_1(AK032238|pid:none) Mus musculus adult male olfactory ...    54   1e-05
BX950229_1251(BX950229|pid:none) Methanococcus maripaludis strai...    54   1e-05
AE017333_903(AE017333|pid:none) Bacillus licheniformis DSM 13, c...    53   2e-05
(Q5R4S0) RecName: Full=5'-AMP-activated protein kinase subunit g...    53   2e-05
CP000814_997(CP000814|pid:none) Campylobacter jejuni subsp. jeju...    53   2e-05
AJ248284_46(AJ248284|pid:none) Pyrococcus abyssi complete genome...    53   2e-05
AL111168_995(AL111168|pid:none) Campylobacter jejuni subsp. jeju...    53   2e-05
AE016823_245(AE016823|pid:none) Leptospira interrogans serovar C...    53   2e-05
CP000025_1162(CP000025|pid:none) Campylobacter jejuni RM1221, co...    53   2e-05
CP000267_1600(CP000267|pid:none) Rhodoferax ferrireducens T118, ...    53   2e-05
CP001251_690(CP001251|pid:none) Dictyoglomus turgidum DSM 6724, ...    53   2e-05
CP001213_1041(CP001213|pid:none) Bifidobacterium animalis subsp....    53   2e-05
AM114193_2111(AM114193|pid:none) Uncultured methanogenic archaeo...    53   2e-05
CP000682_764(CP000682|pid:none) Metallosphaera sedula DSM 5348, ...    53   2e-05
BA000023_2516(BA000023|pid:none) Sulfolobus tokodaii str. 7 DNA,...    53   2e-05
CP001515_505(CP001515|pid:none) Bifidobacterium animalis subsp. ...    53   2e-05
CP000094_4266(CP000094|pid:none) Pseudomonas fluorescens Pf0-1, ...    53   2e-05
CP000768_549(CP000768|pid:none) Campylobacter jejuni subsp. doyl...    53   2e-05
CP001337_3282(CP001337|pid:none) Chloroflexus aggregans DSM 9485...    53   2e-05
AM114193_1559(AM114193|pid:none) Uncultured methanogenic archaeo...    53   2e-05
CP000749_690(CP000749|pid:none) Marinomonas sp. MWYL1, complete ...    53   2e-05
CP001095_559(CP001095|pid:none) Bifidobacterium longum subsp. in...    53   2e-05
AP009049_1441(AP009049|pid:none) Clostridium kluyveri NBRC 12016...    53   2e-05
CP000780_1709(CP000780|pid:none) Candidatus Methanoregula boonei...    53   2e-05
CP000562_1562(CP000562|pid:none) Methanoculleus marisnigri JR1, ...    53   2e-05
AL646052_130(AL646052|pid:none) Ralstonia solanacearum GMI1000 c...    53   2e-05
CP000562_343(CP000562|pid:none) Methanoculleus marisnigri JR1, c...    53   2e-05
CP000316_209(CP000316|pid:none) Polaromonas sp. JS666, complete ...    53   2e-05
CP001392_1789(CP001392|pid:none) Diaphorobacter sp. TPSY, comple...    53   2e-05
CP000390_2219(CP000390|pid:none) Mesorhizobium sp. BNC1, complet...    53   2e-05
CP000867_1408(CP000867|pid:none) Methanococcus maripaludis C6, c...    53   2e-05
CP000742_660(CP000742|pid:none) Methanococcus vannielii SB, comp...    53   2e-05
AE004969_1464(AE004969|pid:none) Neisseria gonorrhoeae FA 1090, ...    53   2e-05
CP000879_1842(CP000879|pid:none) Petrotoga mobilis SJ95, complet...    53   2e-05
BX842651_254(BX842651|pid:none) Bdellovibrio bacteriovorus compl...    53   2e-05
CP000806_4203(CP000806|pid:none) Cyanothece sp. ATCC 51142 circu...    53   2e-05
CP001339_2493(CP001339|pid:none) Thioalkalivibrio sp. HL-EbGR7, ...    53   2e-05
CP001052_808(CP001052|pid:none) Burkholderia phytofirmans PsJN c...    53   2e-05
CP000816_1087(CP000816|pid:none) Ignicoccus hospitalis KIN4/I, c...    53   2e-05
FM954972_1979(FM954972|pid:none) Vibrio splendidus LGP32 chromos...    53   2e-05
CP001638_494(CP001638|pid:none) Geobacillus sp. WCH70, complete ...    53   2e-05
AE017285_1903(AE017285|pid:none) Desulfovibrio vulgaris subsp. v...    53   2e-05
FM178281_1(FM178281|pid:none) Carassius carassius partial mRNA f...    53   2e-05
CP000804_201(CP000804|pid:none) Roseiflexus castenholzii DSM 139...    53   2e-05
CP000493_1103(CP000493|pid:none) Hyperthermus butylicus DSM 5456...    53   2e-05
CP001037_267(CP001037|pid:none) Nostoc punctiforme PCC 73102, co...    53   2e-05
CP000909_598(CP000909|pid:none) Chloroflexus aurantiacus J-10-fl...    53   2e-05
AE000666_139(AE000666|pid:none) Methanothermobacter thermautotro...    52   3e-05
CP000462_1907(CP000462|pid:none) Aeromonas hydrophila subsp. hyd...    52   3e-05
AP009380_247(AP009380|pid:none) Porphyromonas gingivalis ATCC 33...    52   3e-05
BA000002_281(BA000002|pid:none) Aeropyrum pernix K1 DNA, complet...    52   3e-05
U31567_2(U31567|pid:none) Methanopyrus kandleri coenzyme F420-de...    52   3e-05
CP001359_4168(CP001359|pid:none) Anaeromyxobacter dehalogenans 2...    52   3e-05
CP000103_1192(CP000103|pid:none) Nitrosospira multiformis ATCC 2...    52   3e-05
(P50100) RecName: Full=Uncharacterized protein MK0525; AltName: ...    52   3e-05
CP000767_466(CP000767|pid:none) Campylobacter curvus 525.92, com...    52   3e-05
CP001146_580(CP001146|pid:none) Dictyoglomus thermophilum H-6-12...    52   3e-05
AM114193_1530(AM114193|pid:none) Uncultured methanogenic archaeo...    52   3e-05
CP000487_578(CP000487|pid:none) Campylobacter fetus subsp. fetus...    52   3e-05
AE000666_1203(AE000666|pid:none) Methanothermobacter thermautotr...    52   3e-05
AM114193_1195(AM114193|pid:none) Uncultured methanogenic archaeo...    52   3e-05
AY714839_13(AY714839|pid:none) Uncultured archaeon GZfos26B2 clo...    52   3e-05
CP001026_1306(CP001026|pid:none) Burkholderia ambifaria MC40-6 c...    52   3e-05
CP001034_1629(CP001034|pid:none) Natranaerobius thermophilus JW/...    52   4e-05
AE017224_770(AE017224|pid:none) Brucella abortus biovar 1 str. 9...    52   4e-05
AE014295_1637(AE014295|pid:none) Bifidobacterium longum NCC2705,...    52   4e-05
CP000503_3412(CP000503|pid:none) Shewanella sp. W3-18-1, complet...    52   4e-05
CP000088_1308(CP000088|pid:none) Thermobifida fusca YX, complete...    52   4e-05
CP001634_26(CP001634|pid:none) Kosmotoga olearia TBF 19.5.1, com...    52   4e-05
AE010299_4531(AE010299|pid:none) Methanosarcina acetivorans str....    52   4e-05
CP000235_77(CP000235|pid:none) Anaplasma phagocytophilum HZ, com...    52   4e-05
AM946015_428(AM946015|pid:none) Streptococcus uberis 0140J compl...    52   4e-05
CP000088_2589(CP000088|pid:none) Thermobifida fusca YX, complete...    52   4e-05
CP001098_709(CP001098|pid:none) Halothermothrix orenii H 168, co...    52   4e-05
CP000382_397(CP000382|pid:none) Clostridium novyi NT, complete g...    52   4e-05
CP001562_165(CP001562|pid:none) Bartonella grahamii as4aup, comp...    52   4e-05
CP001365_1606(CP001365|pid:none) Halorubrum lacusprofundi ATCC 4...    52   4e-05
CP000745_1271(CP000745|pid:none) Methanococcus maripaludis C7, c...    52   4e-05
CP000697_1607(CP000697|pid:none) Acidiphilium cryptum JF-5, comp...    52   4e-05
AB169499_1(AB169499|pid:none) Macaca fascicularis brain cDNA, cl...    52   4e-05
CP001279_668(CP001279|pid:none) Nautilia profundicola AmH, compl...    52   4e-05
(P54619) RecName: Full=5'-AMP-activated protein kinase subunit g...    52   4e-05
AE008918_897(AE008918|pid:none) Brucella melitensis 16M chromoso...    52   4e-05
EF016456_1(EF016456|pid:none) Chiloscyllium punctatum AMP-activa...    52   4e-05
AP006840_1805(AP006840|pid:none) Symbiobacterium thermophilum IA...    52   4e-05
(P80385) RecName: Full=5'-AMP-activated protein kinase subunit g...    52   4e-05
CP000812_460(CP000812|pid:none) Thermotoga lettingae TMO, comple...    52   4e-05
AB174631_1(AB174631|pid:none) Macaca fascicularis brain cDNA clo...    52   4e-05
(Q09138) RecName: Full=5'-AMP-activated protein kinase subunit g...    52   4e-05
AK097606_1(AK097606|pid:none) Homo sapiens cDNA FLJ40287 fis, cl...    52   4e-05
AE017261_470(AE017261|pid:none) Picrophilus torridus DSM 9790, c...    52   4e-05
DQ318140_1(DQ318140|pid:none) Equus caballus AMPK-activated prot...    52   4e-05
CP000254_2816(CP000254|pid:none) Methanospirillum hungatei JF-1,...    52   5e-05
DQ133598_1(DQ133598|pid:none) Gallus gallus 5'-AMP-activated pro...    52   5e-05
DQ133597_1(DQ133597|pid:none) Gallus gallus 5'-AMP-activated pro...    52   5e-05
CP000742_1377(CP000742|pid:none) Methanococcus vannielii SB, com...    52   5e-05
CP000507_2328(CP000507|pid:none) Shewanella amazonensis SB2B, co...    52   5e-05
CP001399_2668(CP001399|pid:none) Sulfolobus islandicus L.S.2.15,...    52   5e-05
CP001032_3279(CP001032|pid:none) Opitutus terrae PB90-1, complet...    52   5e-05
CP000031_1773(CP000031|pid:none) Ruegeria pomeroyi DSS-3, comple...    52   5e-05
AE009441_2342(AE009441|pid:none) Pyrobaculum aerophilum str. IM2...    52   5e-05
CP000158_1774(CP000158|pid:none) Hyphomonas neptunium ATCC 15444...    52   5e-05
CP000563_3601(CP000563|pid:none) Shewanella baltica OS155, compl...    52   5e-05
BC166111_1(BC166111|pid:none) Xenopus tropicalis hypothetical pr...    52   5e-05
CP000422_1143(CP000422|pid:none) Pediococcus pentosaceus ATCC 25...    52   5e-05
BA000031_958(BA000031|pid:none) Vibrio parahaemolyticus RIMD 221...    52   5e-05
CP000090_359(CP000090|pid:none) Ralstonia eutropha JMP134 chromo...    52   5e-05
CP001338_2535(CP001338|pid:none) Candidatus Methanosphaerula pal...    52   5e-05

>CT009609_17(CT009609|pid:none) Desulfococcus multivorans vrl
           island.
          Length = 309

 Score = 92.4 bits (228), Expect = 2e-17
 Identities = 52/133 (39%), Positives = 81/133 (60%)
 Frame = +2

Query: 68  VLVKQLMSKSLFTINLDTTLDVALKSLNANSIHRLPVVDNDGNLKGIITDRDLRLATDSP 247
           +LVK  MS+ L T+++D  +  A+K +  N IH LPV+D +  L GIITDRDL+ A+ S
Sbjct: 79  MLVKNWMSRRLITVDIDAAMADAVKLMKTNDIHLLPVLDGE-KLSGIITDRDLKRASASD 137

Query: 248 FLPENNEDRLEKLRLHKVSSIMKQNPVTIEDFSPVVEAAKLMRVTNVGGLPVLDKKGRLI 427
                  + +  L   +VS IM +  +T+   + V EAA+++    + G PV+D  GRL+
Sbjct: 138 ATALEMYELIYLLSKIRVSDIMTRKIITLAPDTTVEEAAEVLLKQKISGAPVVDDAGRLL 197

Query: 428 GMVTRSDLLDLLI 466
           G++T+SDL  +LI
Sbjct: 198 GVITKSDLFRMLI 210

 Score = 42.0 bits (97), Expect = 0.037
 Identities = 21/54 (38%), Positives = 32/54 (59%)
 Frame = +2

Query: 65  KVLVKQLMSKSLFTINLDTTLDVALKSLNANSIHRLPVVDNDGNLKGIITDRDL 226
           K+ V  +M++ + T+  DTT++ A + L    I   PVVD+ G L G+IT  DL
Sbjct: 152 KIRVSDIMTRKIITLAPDTTVEEAAEVLLKQKISGAPVVDDAGRLLGVITKSDL 205

Lambda     K      H
   0.318    0.134    0.401

Gapped
Lambda     K      H
   0.267   0.0410    0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3236559
Number of Hits to DB: 1,213,384,260
Number of extensions: 19136695
Number of successful extensions: 52469
Number of sequences better than 10.0: 2195
Number of HSP's gapped: 50650
Number of HSP's successfully gapped: 3061
Length of query: 358
Length of database: 1,051,180,864
Length adjustment: 130
Effective length of query: 228
Effective length of database: 630,428,194
Effective search space: 143737628232
Effective search space used: 143737628232
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)




Dictyostelium discoideum cDNA Project Home