Homology Contig-U11806-1 vs Protein

Query= Contig-U11806-1 (Contig-U11806-1Q) /CSM_Contig/Contig-U11806-1Q.Seq.d
         (1162 letters)

Database: nrp_B
           3,236,559 sequences; 1,051,180,864 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

FJ214098_4(FJ214098|pid:none) Capnocytophaga canimorsus strain 5...    35   6.7

>FJ214098_4(FJ214098|pid:none) Capnocytophaga canimorsus strain 5
            putative dTDP-4-dehydrorhamnose 3,5-epimerase, putative
            UDP-N-acylglucosamine 2-epimerase, putative
            glycosyltransferase (gtf), putative NAD-dependent
            epimerase/dehydratase, putative sugar transferase,
            putative UDP-GlcNAc-4,6-dehydratase, putative
            glucose-1-phosphate thymidylyltransferase, putative
            ATPase, putative dTDP-4-dehydrorhamnose 3,5-epimerase,
            and putative dTDP-4-dehydrorhamnose reductase genes,
            complete cds.
          Length = 298

 Score = 34.7 bits (78), Expect = 6.7
 Identities = 18/72 (25%), Positives = 31/72 (43%)
 Frame = +1

Query: 796  CLLEKEATKGHIRLFKALVDNGYKSIFSKRSNDSKSIFDQIQLREILYRALNNNHLQLSL 975
            C++  E  KG++ L   +V+ G     +   N  +S      L  +++  LNN H+   +
Sbjct: 145  CMIHGEGNKGNLNLLYKIVEKGIPWFLASYEN-KRSFLSIDNLNYLIFEILNNEHIPSGI 203

Query: 976  YLLEDCNISITN 1011
            Y   D     TN
Sbjct: 204  YNFADDEALSTN 215

Lambda     K      H
   0.318    0.134    0.401

Gapped
Lambda     K      H
   0.267   0.0410    0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3236559
Number of Hits to DB: 1,132,462,389
Number of extensions: 19188968
Number of successful extensions: 51028
Number of sequences better than 10.0: 1
Number of HSP's gapped: 51014
Number of HSP's successfully gapped: 1
Length of query: 387
Length of database: 1,051,180,864
Length adjustment: 130
Effective length of query: 257
Effective length of database: 630,428,194
Effective search space: 162020045858
Effective search space used: 162020045858
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)