Homology Contig-U11415-1 vs Protein

Query= Contig-U11415-1 (Contig-U11415-1Q) /CSM_Contig/Contig-U11415-1Q.Seq.d
         (1342 letters)

Database: nrp_A
           3,204,285 sequences; 1,040,966,779 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AK075458_1(AK075458|pid:none) Homo sapiens cDNA PSEC0151 fis, cl...    36   2.7
(Q9BTY2) RecName: Full=Plasma alpha-L-fucosidase;          EC=3....    36   2.7
AL844509_427(AL844509|pid:none) Plasmodium falciparum 3D7 chromo...    36   3.6
(Q54HT7) RecName: Full=Arrestin domain-containing protein F;           35   8.0

>AK075458_1(AK075458|pid:none) Homo sapiens cDNA PSEC0151 fis, clone
           PLACE1007878, highly similar to Fucosidase, alpha-L- 2,
           plasma.  &AX136247_1(AX136247|pid:none)
           &CS051283_1(CS051283|pid:none)
          Length = 467

 Score = 36.2 bits (82), Expect = 2.7
 Identities = 23/71 (32%), Positives = 38/71 (53%), Gaps = 7/71 (9%)
 Frame = +3

Query: 567 SIFQLISRLVESSMAVGNVFLKIGP----LISLAFQFAVSQVDSKLKSSALSVITSY--- 725
           +I +L+ +LVE+    GN+ + IGP     IS+ F+  + QV S LK +  ++  +Y
Sbjct: 315 TIEELVKQLVETVSCGGNLLMNIGPTLDGTISVVFEERLRQVGSWLKVNGEAIYETYTWR 374

Query: 726 SQYPIYVADIW 758
           SQ      D+W
Sbjct: 375 SQNDTVTPDVW 385

Lambda     K      H
   0.318    0.134    0.401

Gapped
Lambda     K      H
   0.267   0.0410    0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3204285
Number of Hits to DB: 1,749,910,814
Number of extensions: 32024479
Number of successful extensions: 71724
Number of sequences better than 10.0: 4
Number of HSP's gapped: 71711
Number of HSP's successfully gapped: 4
Length of query: 447
Length of database: 1,040,966,779
Length adjustment: 132
Effective length of query: 315
Effective length of database: 618,001,159
Effective search space: 194670365085
Effective search space used: 194670365085
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)