Translated Amino Acid Sequence Contig-U09777-1

Frame A:
ilifififlvymkilk**in*ngdlkqlllyyf*fl*q*sq*qvlnfykkllk*nkhqil
ylkkknhh**ekkxxx---

---frks*kc*ihfp*kllw*yftftni*fkfn*iefleftk*sfklffifk**cvf**t
s*ke*lfl**si*skdl*nsrknpsf**akeirtlc*iirlfkfnik*nlgrr*ekiftr
swrssl**kdlvndt*pii*frs*pnffk*v*riirftiilyl*svc*tlfksi*igfkr
c*slcwnle**eny**cy**n*f*tkkmq*qfv*mmvlillmmksiqn*qiysihyflkn
hhlkikkkk*ikikkikkynnink

Frame B:
flflflff*fi*ky*ndk*tkmei*nncyciifsfynnnlndkf*iftrnc*nrtnikyf
i*krriiinrkkkxxx---

---SENPENVKFIFHKNYYGNISHLPTYSSNSIESNFWNLPNEVSNCFLYLNDDVFFNRP
VEKSDYFYDDQFNQKIYEIQERTQVFNEQKKLEPYAKSFAYSNSILNKIWGEDKRRFLPD
HGVQVYNKKIWLMIHDQLFDFGLDQTSSNRFRESSDLQLSFIYNQFAKRYSNQFKLASKG
ANLYVGIWNDEKIINNAINRINFKRKKCNDNLFK*wf*fc***npfkinkfiryiis*ki
ti*klkkknk*k*kklkniii*in

Frame C:
SYFYFYFFSLYENIKMINKLKWRFKTIAIVLFLVFITIISMTSFEFLQEIVEIEQTSNTL
FKKEESSLIGKKKXXX---

---qkilkmlnsfsikiimvifhiyqhivqiqlnrifgiyqmkfqivfyi*mmmcflidq
lkrviifmminlikrfmkfkkepkflmskrn*nlmlnhsliqiqy*ikfgekiredfyqi
mafkfiikrfg**ymtnylisvltkllqiglenhqiynyplfiisllnviqinlnwlqkv
lifmlefgmmrkllimllielilneknamticlndgfdfvddeihskltnlfdtlfpeks
pfen*kkkinknkkn*ki**yk*


Dictyostelium discoideum cDNA Project Home