Homology Contig-U09597-1 vs Protein

Query= Contig-U09597-1 (Contig-U09597-1Q) /CSM_Contig/Contig-U09597-1Q.Seq.d
         (1093 letters)

Database: nrp_A
           3,204,285 sequences; 1,040,966,779 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF486523_1(EF486523|pid:none) Bacillus thuringiensis strain BTH-...    35   3.5
EU124375_1(EU124375|pid:none) Bacillus thuringiensis strain DAB-...    35   4.6
(O25827) RecName: Full=Aspartokinase;          EC=2.7.2.4; AltNa...    35   4.6
CP001217_1188(CP001217|pid:none) Helicobacter pylori P12, comple...    35   4.6
CP001072_1204(CP001072|pid:none) Helicobacter pylori Shi470, com...    35   4.6
CU207366_2023(CU207366|pid:none) Gramella forsetii KT0803 comple...    34   7.8

>EF486523_1(EF486523|pid:none) Bacillus thuringiensis strain BTH-13
           pesticidal crystal protein (cry) gene, complete cds.
          Length = 1144

 Score = 35.4 bits (80), Expect = 3.5
 Identities = 18/62 (29%), Positives = 31/62 (50%)
 Frame = +3

Query: 264 EVIRFVTPEEFESRLNSFRRQMEDFVNQKLDQTYVSIANSHHRALQKILNRYHELIVTFE 443
           EV+R + P +      SF  ++E  +NQ++ +  VS A S    L+  L  Y   +  ++
Sbjct: 83  EVLRLLWPNKQNDLWESFMNEVEALINQEITEAVVSKALSELEGLRNALEGYTSALEAWQ 142

Query: 444 NN 449
           NN
Sbjct: 143 NN 144

Lambda     K      H
   0.318    0.134    0.401

Gapped
Lambda     K      H
   0.267   0.0410    0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3204285
Number of Hits to DB: 1,408,808,157
Number of extensions: 24578601
Number of successful extensions: 86132
Number of sequences better than 10.0: 6
Number of HSP's gapped: 86105
Number of HSP's successfully gapped: 6
Length of query: 364
Length of database: 1,040,966,779
Length adjustment: 130
Effective length of query: 234
Effective length of database: 624,409,729
Effective search space: 146111876586
Effective search space used: 146111876586
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)