Homology Contig-U07417-1 vs Protein
Query= Contig-U07417-1 (Contig-U07417-1Q) /CSM_Contig/Contig-U07417-1Q.Seq.d
(531 letters)
Database: nrp_A
3,204,285 sequences; 1,040,966,779 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AY815103_1(AY815103|pid:none) Schistosoma japonicum SJCHGC06152 ... 55 1e-06
FN357601_12(FN357601|pid:none) Schistosoma mansoni genome sequen... 52 9e-06
AK223438_1(AK223438|pid:none) Homo sapiens mRNA for FGF intracel... 45 0.001
(O46431) RecName: Full=Acidic fibroblast growth factor intracell... 45 0.001
(O43427) RecName: Full=Acidic fibroblast growth factor intracell... 45 0.001
BC110265_1(BC110265|pid:none) Bos taurus fibroblast growth facto... 44 0.002
AE014296_3417(AE014296|pid:none) Drosophila melanogaster chromos... 44 0.003
BC031716_1(BC031716|pid:none) Mus musculus fibroblast growth fac... 44 0.003
(Q9JI19) RecName: Full=Acidic fibroblast growth factor intracell... 44 0.003
AF457578_1(AF457578|pid:none) Drosophila melanogaster aFGF intra... 44 0.003
BC061802_1(BC061802|pid:none) Rattus norvegicus fibroblast growt... 44 0.003
AY093421_1(AY093421|pid:none) Rattus norvegicus fibroblast growt... 41 0.016
AY427781_1(AY427781|pid:none) Danio rerio aFGF intracellular bin... 40 0.036
BC054612_1(BC054612|pid:none) Danio rerio fibroblast growth fact... 39 0.080
CR626869_9(CR626869|pid:none) Zebrafish DNA sequence from clone ... 39 0.080
BC097711_1(BC097711|pid:none) Xenopus laevis hypothetical protei... 38 0.14
CU928168_531(CU928168|pid:none) Kluyveromyces thermotolerans str... 35 0.89
FM992693_135(FM992693|pid:none) Candida dubliniensis CD36 chromo... 35 0.90
T18720(T18720) hypothetical protein B0379.2 - Caenorhabditis ele... 35 1.5
T26420(T26420)hypothetical protein Y106G6E.3 - Caenorhabditis el... 34 2.0
AE000512_88(AE000512|pid:none) Thermotoga maritima MSB8, complet... 34 2.6
CP000312_101(CP000312|pid:none) Clostridium perfringens SM101, c... 33 3.4
CP000097_70(CP000097|pid:none) Synechococcus sp. CC9902, complet... 33 4.4
AJ871375_1(AJ871375|pid:none) Paramecium tetraurelia dna-PKcs ge... 33 4.4
BA000016_117(BA000016|pid:none) Clostridium perfringens str. 13 ... 33 4.5
CR380958_472(CR380958|pid:none) Candida glabrata strain CBS138 c... 32 9.8
CR382136_99(CR382136|pid:none) Debaryomyces hansenii strain CBS7... 32 9.8
AJ720384_1(AJ720384|pid:none) Gallus gallus mRNA for hypothetica... 32 9.8
>AY815103_1(AY815103|pid:none) Schistosoma japonicum SJCHGC06152
protein mRNA, complete cds.
Length = 366
Score = 55.1 bits (131), Expect = 1e-06
Identities = 33/112 (29%), Positives = 54/112 (48%)
Frame = +2
Query: 125 ITATMNSILTQEKLKNLELKFRSILKGILVIGSNLSDSKEFRNLFEDIVEKVIEPLKRME 304
+ ++ I + L NLE F+SI K ++ + LS ++E RN F DI+EK++EP++ +
Sbjct: 258 VIRNLSEIQAKIILTNLESNFKSISKAVINLACGLSHAREMRNFFLDIIEKLVEPMRALN 317
Query: 305 MVMDEVNPFFYFLIELFSPEQLGIHSLRHRDRVVHNWKSFLEGIRRVVIYLY 460
EV FF LG S + + W F+ V++LY
Sbjct: 318 WPSKEVKMFFDAYHNTVKALPLGRSS-----KFLSIWTRFIVPFSNCVMHLY 364
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3204285
Number of Hits to DB: 541,399,553
Number of extensions: 9108261
Number of successful extensions: 31562
Number of sequences better than 10.0: 28
Number of HSP's gapped: 31557
Number of HSP's successfully gapped: 28
Length of query: 177
Length of database: 1,040,966,779
Length adjustment: 120
Effective length of query: 57
Effective length of database: 656,452,579
Effective search space: 37417797003
Effective search space used: 37417797003
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 30 (16.2 bits)
Dictyostelium discoideum cDNA Project Home