Homology Contig-U07417-1 vs Protein

Query= Contig-U07417-1 (Contig-U07417-1Q) /CSM_Contig/Contig-U07417-1Q.Seq.d
         (531 letters)

Database: nrp_A
           3,204,285 sequences; 1,040,966,779 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY815103_1(AY815103|pid:none) Schistosoma japonicum SJCHGC06152 ...    55   1e-06
FN357601_12(FN357601|pid:none) Schistosoma mansoni genome sequen...    52   9e-06
AK223438_1(AK223438|pid:none) Homo sapiens mRNA for FGF intracel...    45   0.001
(O46431) RecName: Full=Acidic fibroblast growth factor intracell...    45   0.001
(O43427) RecName: Full=Acidic fibroblast growth factor intracell...    45   0.001
BC110265_1(BC110265|pid:none) Bos taurus fibroblast growth facto...    44   0.002
AE014296_3417(AE014296|pid:none) Drosophila melanogaster chromos...    44   0.003
BC031716_1(BC031716|pid:none) Mus musculus fibroblast growth fac...    44   0.003
(Q9JI19) RecName: Full=Acidic fibroblast growth factor intracell...    44   0.003
AF457578_1(AF457578|pid:none) Drosophila melanogaster aFGF intra...    44   0.003
BC061802_1(BC061802|pid:none) Rattus norvegicus fibroblast growt...    44   0.003
AY093421_1(AY093421|pid:none) Rattus norvegicus fibroblast growt...    41   0.016
AY427781_1(AY427781|pid:none) Danio rerio aFGF intracellular bin...    40   0.036
BC054612_1(BC054612|pid:none) Danio rerio fibroblast growth fact...    39   0.080
CR626869_9(CR626869|pid:none) Zebrafish DNA sequence from clone ...    39   0.080
BC097711_1(BC097711|pid:none) Xenopus laevis hypothetical protei...    38   0.14
CU928168_531(CU928168|pid:none) Kluyveromyces thermotolerans str...    35   0.89
FM992693_135(FM992693|pid:none) Candida dubliniensis CD36 chromo...    35   0.90
T18720(T18720) hypothetical protein B0379.2 - Caenorhabditis ele...    35   1.5
T26420(T26420)hypothetical protein Y106G6E.3 - Caenorhabditis el...    34   2.0
AE000512_88(AE000512|pid:none) Thermotoga maritima MSB8, complet...    34   2.6
CP000312_101(CP000312|pid:none) Clostridium perfringens SM101, c...    33   3.4
CP000097_70(CP000097|pid:none) Synechococcus sp. CC9902, complet...    33   4.4
AJ871375_1(AJ871375|pid:none) Paramecium tetraurelia dna-PKcs ge...    33   4.4
BA000016_117(BA000016|pid:none) Clostridium perfringens str. 13 ...    33   4.5
CR380958_472(CR380958|pid:none) Candida glabrata strain CBS138 c...    32   9.8
CR382136_99(CR382136|pid:none) Debaryomyces hansenii strain CBS7...    32   9.8
AJ720384_1(AJ720384|pid:none) Gallus gallus mRNA for hypothetica...    32   9.8

>AY815103_1(AY815103|pid:none) Schistosoma japonicum SJCHGC06152
           protein mRNA, complete cds.
          Length = 366

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 33/112 (29%), Positives = 54/112 (48%)
 Frame = +2

Query: 125 ITATMNSILTQEKLKNLELKFRSILKGILVIGSNLSDSKEFRNLFEDIVEKVIEPLKRME 304
           +   ++ I  +  L NLE  F+SI K ++ +   LS ++E RN F DI+EK++EP++ +
Sbjct: 258 VIRNLSEIQAKIILTNLESNFKSISKAVINLACGLSHAREMRNFFLDIIEKLVEPMRALN 317

Query: 305 MVMDEVNPFFYFLIELFSPEQLGIHSLRHRDRVVHNWKSFLEGIRRVVIYLY 460
               EV  FF           LG  S     + +  W  F+      V++LY
Sbjct: 318 WPSKEVKMFFDAYHNTVKALPLGRSS-----KFLSIWTRFIVPFSNCVMHLY 364

Lambda     K      H
   0.318    0.134    0.401

Gapped
Lambda     K      H
   0.267   0.0410    0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3204285
Number of Hits to DB: 541,399,553
Number of extensions: 9108261
Number of successful extensions: 31562
Number of sequences better than 10.0: 28
Number of HSP's gapped: 31557
Number of HSP's successfully gapped: 28
Length of query: 177
Length of database: 1,040,966,779
Length adjustment: 120
Effective length of query: 57
Effective length of database: 656,452,579
Effective search space: 37417797003
Effective search space used: 37417797003
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 30 (16.2 bits)




Dictyostelium discoideum cDNA Project Home