Homology Contig-U06738-1 vs Protein

Query= Contig-U06738-1 (Contig-U06738-1Q) /CSM_Contig/Contig-U06738-1Q.Seq.d
         (260 letters)

Database: nrp_A
           3,204,285 sequences; 1,040,966,779 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AL844509_567(AL844509|pid:none) Plasmodium falciparum 3D7 chromo...    37   0.28
CP000939_359(CP000939|pid:none) Clostridium botulinum B1 str. Ok...    33   4.0
DQ927304_24(DQ927304|pid:none) Tetrahymena paravorax strain RP m...    33   4.0
AE014187_405(AE014187|pid:none) Plasmodium falciparum 3D7 chromo...    32   6.9
(Q54LB7) RecName: Full=Putative uncharacterized transmembrane pr...    32   6.9
AP009180_93(AP009180|pid:none) Candidatus Carsonella ruddii PV D...    32   9.0

>AL844509_567(AL844509|pid:none) Plasmodium falciparum 3D7
           chromosome 13.  &DQ986369_1(DQ986369|pid:none)
          Length = 340

 Score = 36.6 bits (83), Expect = 0.28
 Identities = 20/55 (36%), Positives = 31/55 (56%), Gaps = 2/55 (3%)
 Frame = +3

Query: 21  IFNQILFHCVFYFLKVSNNYYYINTSLLYIYF--FIVNIHTSTHSHFYNIVVQYC 179
           ++   + H +F++ K   N+Y INTS LY +F  FI ++     SHF +IV   C
Sbjct: 275 LYGMHITHVIFFYFK---NHYVINTSFLYNFFYSFISSLLLENVSHFNHIVGFLC 326

Lambda     K      H
   0.318    0.134    0.401

Gapped
Lambda     K      H
   0.267   0.0410    0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3204285
Number of Hits to DB: 346,577,787
Number of extensions: 6580453
Number of successful extensions: 14214
Number of sequences better than 10.0: 6
Number of HSP's gapped: 14159
Number of HSP's successfully gapped: 6
Length of query: 86
Length of database: 1,040,966,779
Length adjustment: 56
Effective length of query: 30
Effective length of database: 861,526,819
Effective search space: 25845804570
Effective search space used: 25845804570
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 27 (15.0 bits)