Homology Contig-U05162-1 vs Protein
Query= Contig-U05162-1 (Contig-U05162-1Q) /CSM_Contig/Contig-U05162-1Q.Seq.d
(808 letters)
Database: nrp_A
3,268,448 sequences; 1,061,185,681 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AC117176_22(AC117176|pid:none) Dictyostelium discoideum chromoso... 421 e-116
CP001463_1578(CP001463|pid:none) Thermococcus sibiricus MM 739, ... 100 1e-19
A75053(A75053) alanine-tRNA ligase truncated homolog PAB1440 - P... 96 1e-18
B71172(B71172) alanine-tRNA ligase truncated homolog PH0574 - Py... 94 7e-18
CP000077_1085(CP000077|pid:none) Sulfolobus acidocaldarius DSM 6... 89 2e-16
CP000855_1438(CP000855|pid:none) Thermococcus onnurineus NA1, co... 88 4e-16
CP001400_400(CP001400|pid:none) Sulfolobus islandicus M.14.25, c... 86 1e-15
CP000682_405(CP000682|pid:none) Metallosphaera sedula DSM 5348, ... 82 2e-14
AE006641_1145(AE006641|pid:none) Sulfolobus solfataricus P2, com... 79 1e-13
CP001398_2081(CP001398|pid:none) Thermococcus gammatolerans EJ3,... 60 1e-07
(P35029) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 58 4e-07
(A3DNI3) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 56 2e-06
(Q9Y9X3) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 53 1e-05
(Q6FZF1) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 53 1e-05
(A9IVY8) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 52 2e-05
CP001404_952(CP001404|pid:none) Sulfolobus islandicus Y.N.15.51,... 52 3e-05
(Q6G2Z4) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 52 3e-05
CP001399_1746(CP001399|pid:none) Sulfolobus islandicus L.S.2.15,... 52 3e-05
CP001403_1843(CP001403|pid:none) Sulfolobus islandicus Y.G.57.14... 52 3e-05
CP001562_1136(CP001562|pid:none) Bartonella grahamii as4aup, com... 50 7e-05
CP001401_1725(CP001401|pid:none) Sulfolobus islandicus M.16.27, ... 50 7e-05
CP001400_1618(CP001400|pid:none) Sulfolobus islandicus M.14.25, ... 50 7e-05
(A1RT13) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 50 1e-04
CP001398_311(CP001398|pid:none) Thermococcus gammatolerans EJ3, ... 49 3e-04
GM015171_230(GM015171|pid:none) Sequence 1 from Patent EP1923464. 49 3e-04
CP000855_1736(CP000855|pid:none) Thermococcus onnurineus NA1, co... 48 3e-04
CP001338_1225(CP001338|pid:none) Candidatus Methanosphaerula pal... 48 3e-04
CR940347_701(CR940347|pid:none) Theileria annulata strain Ankara... 48 4e-04
(Q8U425) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 48 4e-04
(Q9UY36) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 46 0.002
(A3CVP2) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 45 0.002
(A1RHG5) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 45 0.002
(Q8ZSV6) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 45 0.002
EU016588_27(EU016588|pid:none) Uncultured Group I marine crenarc... 45 0.002
(A5VQX4) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 45 0.003
CP001196_1415(CP001196|pid:none) Oligotropha carboxidovorans OM5... 45 0.004
(A4WN07) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 45 0.004
(Q2K7T4) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 45 0.004
EU016635_33(EU016635|pid:none) Uncultured Group I marine crenarc... 44 0.005
CP000390_1257(CP000390|pid:none) Mesorhizobium sp. BNC1, complet... 44 0.005
(A6Q576) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 44 0.006
AL844509_363(AL844509|pid:none) Plasmodium falciparum 3D7 chromo... 44 0.006
(Q0HXF8) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 44 0.006
(Q0HL60) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 44 0.006
(A0KU94) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 44 0.006
(A3MXP1) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 44 0.008
(P70865) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 44 0.008
(Q8UE87) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 44 0.008
J01581_1(J01581|pid:none) E. coli alaS gene coding for alanyl-tR... 44 0.008
(A7I7S4) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 44 0.008
F97585(F97585)alanyl-tRNA synthetase RNA ligase) (ALars) (ALani... 44 0.008
CP000628_1968(CP000628|pid:none) Agrobacterium radiobacter K84 c... 44 0.008
(Q4FRQ0) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 44 0.008
(A1USS4) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 44 0.008
(A6VJ32) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 44 0.008
CU928158_352(CU928158|pid:none) Escherichia fergusonii ATCC 3546... 43 0.011
(B1L762) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 43 0.011
CP000472_1305(CP000472|pid:none) Shewanella piezotolerans WP3, c... 43 0.011
(Q2FQD6) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 43 0.014
(A7MJ41) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 43 0.014
(A8MBI2) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 43 0.014
AM114193_79(AM114193|pid:none) Uncultured methanogenic archaeon ... 43 0.014
(Q8EBS1) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 43 0.014
CP001087_2702(CP001087|pid:none) Desulfobacterium autotrophicum ... 42 0.018
(B2UV04) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 42 0.024
(A6UUN3) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 42 0.024
(A4FZA5) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 42 0.024
(A6WR16) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 42 0.024
(A3D783) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 42 0.024
CP001252_1218(CP001252|pid:none) Shewanella baltica OS223, compl... 42 0.024
(B1XCM5) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 42 0.031
CU928163_2962(CU928163|pid:none) Escherichia coli UMN026 chromos... 42 0.031
AE005174_3567(AE005174|pid:none) Escherichia coli O157:H7 EDL933... 42 0.031
(Q32CN1) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 42 0.031
(A1AEN7) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 42 0.031
CU651637_2560(CU651637|pid:none) Escherichia coli LF82 chromosom... 42 0.031
(A7ZQC5) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 42 0.031
(B1IUY2) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 42 0.031
(A8ANQ1) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 42 0.031
(Q0TEI3) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 42 0.031
(P61710) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 41 0.040
(Q2LPL7) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 41 0.040
(B2U049) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 41 0.040
AF245445_1(AF245445|pid:none) Giardia intestinalis alanyl-tRNA s... 41 0.040
AM910991_235(AM910991|pid:none) Plasmodium knowlesi strain H chr... 41 0.053
(Q8P0E6) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 41 0.053
(A1S4E9) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 41 0.053
(Q2ITM9) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 41 0.053
(Q89I89) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 40 0.069
(Q1CS22) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 40 0.069
CP000319_1538(CP000319|pid:none) Nitrobacter hamburgensis X14, c... 40 0.090
(Q1QMV7) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 40 0.090
CP001654_985(CP001654|pid:none) Dickeya dadantii Ech703, complet... 40 0.090
(Q487H5) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 40 0.090
CP001217_1200(CP001217|pid:none) Helicobacter pylori P12, comple... 40 0.090
(A4YXQ6) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 40 0.090
CP000575_1119(CP000575|pid:none) Staphylothermus marinus F1, com... 40 0.090
(A7ZE62) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 40 0.090
(A3QC89) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 40 0.090
AE010299_1963(AE010299|pid:none) Methanosarcina acetivorans str.... 40 0.12
(P43815) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 40 0.12
AE000512_1697(AE000512|pid:none) Thermotoga maritima MSB8, compl... 40 0.12
(Q0TMX8) RecName: Full=Threonyl-tRNA synthetase; EC=6.1... 40 0.12
(A7GZA4) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 40 0.12
(A8FSV6) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 40 0.12
(A2RDY3) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 40 0.12
AP009484_1260(AP009484|pid:none) Macrococcus caseolyticus JCSC54... 40 0.12
(A5UDR0) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 39 0.15
(A6US09) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 39 0.15
(Q18BE7) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 39 0.15
(Q5FQ21) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 39 0.20
(Q3K1P7) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 39 0.20
(Q8E0C4) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 39 0.20
(Q6D1T0) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 39 0.20
CP000916_923(CP000916|pid:none) Thermotoga neapolitana DSM 4359,... 39 0.20
(Q17ZF3) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 39 0.20
CP001186_1567(CP001186|pid:none) Bacillus cereus G9842, complete... 39 0.26
(Q18E76) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 39 0.26
FM204883_658(FM204883|pid:none) Streptococcus equi subsp. equi 4... 39 0.26
CP001393_750(CP001393|pid:none) Anaerocellum thermophilum DSM 67... 39 0.26
CP001279_122(CP001279|pid:none) Nautilia profundicola AmH, compl... 39 0.26
(Q3ST43) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 39 0.26
FM204884_1340(FM204884|pid:none) Streptococcus equi subsp. zooep... 39 0.26
AY568076_1(AY568076|pid:none) Trichomonas vaginalis strain ATCC ... 39 0.26
AE016877_1538(AE016877|pid:none) Bacillus cereus ATCC 14579, com... 39 0.26
(Q0SQM4) RecName: Full=Threonyl-tRNA synthetase; EC=6.1... 38 0.34
CP001129_645(CP001129|pid:none) Streptococcus equi subsp. zooepi... 38 0.34
(B0R7I0) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 38 0.34
CP000702_1010(CP000702|pid:none) Thermotoga petrophila RKU-1, co... 38 0.34
BA000011_767(BA000011|pid:none) Thermoplasma volcanium GSS1 DNA,... 38 0.34
(A0RX10) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 38 0.34
(Q12U25) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 38 0.45
(Q4K843) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 38 0.45
(Q8E600) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 38 0.45
AM942759_369(AM942759|pid:none) Proteus mirabilis strain HI4320,... 38 0.45
AM180355_2233(AM180355|pid:none) Clostridium difficile 630 compl... 38 0.45
(A4WDQ6) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 38 0.45
AM422018_508(AM422018|pid:none) Candidatus Phytoplasma australie... 38 0.45
(B2V3W2) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 38 0.45
AE008384_233(AE008384|pid:none) Methanosarcina mazei strain Goe1... 38 0.45
(Q48SS4) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 37 0.58
(Q1J5Z4) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 37 0.58
CP000829_1039(CP000829|pid:none) Streptococcus pyogenes NZ131, c... 37 0.58
(Q99Z57) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 37 0.58
(Q5XBH1) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 37 0.58
AE014299_1355(AE014299|pid:none) Shewanella oneidensis MR-1, com... 37 0.58
(B0UTE1) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 37 0.76
CP000774_2565(CP000774|pid:none) Parvibaculum lavamentivorans DS... 37 0.76
CP001177_1681(CP001177|pid:none) Bacillus cereus AH187, complete... 37 0.76
(Q65VQ5) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 37 0.76
(A7MYT5) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 37 0.76
CP000049_211(CP000049|pid:none) Borrelia turicatae 91E135, compl... 37 0.76
CP000377_1232(CP000377|pid:none) Silicibacter sp. TM1040, comple... 37 0.76
(Q1GHA1) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 37 0.76
AY568073_1(AY568073|pid:none) Entamoeba moshkovskii strain FIC a... 37 0.76
(Q1I6Z8) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 37 0.76
AP009389_1061(AP009389|pid:none) Pelotomaculum thermopropionicum... 37 0.76
AM946015_1202(AM946015|pid:none) Streptococcus uberis 0140J comp... 37 1.00
(Q8DC49) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 37 1.00
(Q4JVF5) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 37 1.00
(A8F866) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 37 1.00
(Q46CS0) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 37 1.00
(A4J4Y7) RecName: Full=Threonyl-tRNA synthetase; EC=6.1... 37 1.00
(Q7MHR6) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 37 1.00
(Q8CWY0) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 37 1.00
(Q4FMX6) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 36 1.3
(B1IJG7) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 36 1.7
(A5W0D9) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 36 1.7
(A7GGF1) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 36 1.7
CP001655_962(CP001655|pid:none) Dickeya zeae Ech1591, complete g... 36 1.7
CP001581_1204(CP001581|pid:none) Clostridium botulinum A2 str. K... 36 1.7
CP000712_1422(CP000712|pid:none) Pseudomonas putida F1, complete... 36 1.7
CP000446_2805(CP000446|pid:none) Shewanella sp. MR-4, complete g... 36 1.7
(Q6AFA1) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 35 2.2
CP000485_1427(CP000485|pid:none) Bacillus thuringiensis str. Al ... 35 2.2
CP000587_214(CP000587|pid:none) Ostreococcus lucimarinus CCE9901... 35 2.2
BX294154_175(BX294154|pid:none) Rhodopirellula baltica SH 1 comp... 35 2.2
(Q7UJ52) RecName: Full=Threonyl-tRNA synthetase; EC=6.1... 35 2.2
CP001321_427(CP001321|pid:none) Haemophilus parasuis SH0165, com... 35 2.2
CP001283_1681(CP001283|pid:none) Bacillus cereus AH820, complete... 35 2.2
(A3M3W2) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 35 2.9
(Q493M6) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 35 2.9
(A2ST90) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 35 2.9
CP000863_1154(CP000863|pid:none) Acinetobacter baumannii ACICU, ... 35 2.9
CP000964_1082(CP000964|pid:none) Klebsiella pneumoniae 342, comp... 35 2.9
CP000926_3953(CP000926|pid:none) Pseudomonas putida GB-1, comple... 35 2.9
AP009608_434(AP009608|pid:none) Mycoplasma fermentans PG18 DNA, ... 35 2.9
(Q6FCT2) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 35 2.9
(Q5E7G5) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 35 2.9
(A6TCV9) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 35 2.9
CP001139_521(CP001139|pid:none) Vibrio fischeri MJ11 chromosome ... 35 2.9
(B0KR43) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 35 2.9
AP008955_3107(AP008955|pid:none) Brevibacillus brevis NBRC 10059... 35 3.8
AE014187_26(AE014187|pid:none) Plasmodium falciparum 3D7 chromos... 35 3.8
AM431974_3(AM431974|pid:none) Vitis vinifera contig VV78X114542.... 35 3.8
(A8LL20) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 35 3.8
(Q8EPF3) RecName: Full=Threonyl-tRNA synthetase; EC=6.1... 34 5.0
CP000360_4028(CP000360|pid:none) Acidobacteria bacterium Ellin34... 34 5.0
AF297520_1(AF297520|pid:none) Haemophilus ducreyi alanyl-tRNA sy... 34 5.0
AE008691_873(AE008691|pid:none) Thermoanaerobacter tengcongensis... 34 5.0
AE016879_1583(AE016879|pid:none) Bacillus anthracis str. Ames, c... 34 5.0
(Q58791) RecName: Full=Uncharacterized protein MJ1396; &C64474(... 34 5.0
AE014185_47(AE014185|pid:none) Plasmodium falciparum 3D7 chromos... 34 6.5
CP001601_1387(CP001601|pid:none) Corynebacterium aurimucosum ATC... 34 6.5
(Q5LRU1) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 34 6.5
CP001083_2682(CP001083|pid:none) Clostridium botulinum Ba4 str. ... 34 6.5
(Q47N66) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 34 6.5
AE017125_874(AE017125|pid:none) Helicobacter hepaticus ATCC 5144... 34 6.5
AE017333_205(AE017333|pid:none) Bacillus licheniformis DSM 13, c... 34 6.5
(B1KXB7) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 33 8.4
CP001634_2037(CP001634|pid:none) Kosmotoga olearia TBF 19.5.1, c... 33 8.4
CP000606_944(CP000606|pid:none) Shewanella loihica PV-4, complet... 33 8.4
AL445064_172(AL445064|pid:none) Thermoplasma acidophilum complet... 33 8.4
CP000472_4016(CP000472|pid:none) Shewanella piezotolerans WP3, c... 33 8.4
CP001275_1734(CP001275|pid:none) Thermomicrobium roseum DSM 5159... 33 8.4
CP000227_2213(CP000227|pid:none) Bacillus cereus Q1, complete ge... 33 8.4
AP010904_1466(AP010904|pid:none) Desulfovibrio magneticus RS-1 D... 33 8.4
(Q28QV8) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 33 8.4
(A5I4Z5) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 33 8.4
(A2BNH2) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 33 8.4
CP000721_3146(CP000721|pid:none) Clostridium beijerinckii NCIMB ... 33 8.4
CP001634_1567(CP001634|pid:none) Kosmotoga olearia TBF 19.5.1, c... 33 8.4
CU466930_1614(CU466930|pid:none) Candidatus Cloacamonas acidamin... 33 8.4
>AC117176_22(AC117176|pid:none) Dictyostelium discoideum chromosome
2 map 5018074-5200947 strain AX4, complete sequence.
Length = 253
Score = 421 bits (1083), Expect = e-116
Identities = 222/254 (87%), Positives = 222/254 (87%), Gaps = 1/254 (0%)
Frame = +3
Query: 21 MSQSKARDSTTDSACHVLKGAIVKVLGTPITISVECNNKVKGRISVEYEHPEKPSQEL-N 197
MSQSKARDSTTDSACHVLKGAIVKVLGTPITISVECNNKVKGRISVEYEHPEKPSQEL N
Sbjct: 1 MSQSKARDSTTDSACHVLKGAIVKVLGTPITISVECNNKVKGRISVEYEHPEKPSQELIN 60
Query: 198 KIEEEANLIIKQNLEFKTFKIDKKEAESKYKSNLVNNTYIYDKFPVPXXXXXXXXXXXXN 377
KIEEEANLIIKQNLEFKTFKIDKKEAESKYKSNLVNNTYIYDKFPVP N
Sbjct: 61 KIEEEANLIIKQNLEFKTFKIDKKEAESKYKSNLVNNTYIYDKFPVPESVTELSLVELEN 120
Query: 378 WNINCCPAVHLKTTGEIGGIKIAGINHRPAKKELEFRFDIVASVVSTTTAKPTGRGAPKK 557
WNINCCPAVHLKTTGEIGGIKIAGINHRPAKKELEFRFDIVASVVSTTTAKPTGRGAPKK
Sbjct: 121 WNINCCPAVHLKTTGEIGGIKIAGINHRPAKKELEFRFDIVASVVSTTTAKPTGRGAPKK 180
Query: 558 DAAVVNETSFEGSNLNLKDTNVQYLTQKIIKLVLDSKDSKDSXXXXXXXXXXXXXXXXXN 737
DAAVVNETSFEGS NLKDTNVQYLTQKIIKLVLDSKDSKDS N
Sbjct: 181 DAAVVNETSFEGS--NLKDTNVQYLTQKIIKLVLDSKDSKDSEKEQTTLEIEQLLTILKN 238
Query: 738 TSYTNGSQSVIISR 779
TSYTNGSQSVIISR
Sbjct: 239 TSYTNGSQSVIISR 252
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3268448
Number of Hits to DB: 792,358,078
Number of extensions: 12312186
Number of successful extensions: 34233
Number of sequences better than 10.0: 223
Number of HSP's gapped: 34144
Number of HSP's successfully gapped: 223
Length of query: 269
Length of database: 1,061,185,681
Length adjustment: 126
Effective length of query: 143
Effective length of database: 649,361,233
Effective search space: 92858656319
Effective search space used: 92858656319
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)
Dictyostelium discoideum cDNA Project Home