Homology Contig-U00307-1 vs Protein
Query= Contig-U00307-1 (Contig-U00307-1Q) /CSM_Contig/Contig-U00307-1Q.Seq.d
(1509 letters)
Database: nrp_B
3,236,559 sequences; 1,051,180,864 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AF275723_1(AF275723|pid:none) Dictyostelium discoideum Ras guani... 493 e-137
U53884_1(U53884|pid:none) Dictyostelium discoideum aimless RasGE... 169 2e-40
AY160090_1(AY160090|pid:none) Dictyostelium discoideum nucleotid... 169 2e-40
AY160099_1(AY160099|pid:none) Dictyostelium discoideum nucleotid... 160 1e-37
AY160100_1(AY160100|pid:none) Dictyostelium discoideum nucleotid... 156 2e-36
AF474377_1(AF474377|pid:none) Dictyostelium discoideum Ras GTP e... 156 2e-36
AY160098_1(AY160098|pid:none) Dictyostelium discoideum nucleotid... 154 1e-35
AC115682_8(AC115682|pid:none) Dictyostelium discoideum chromosom... 141 7e-32
AC117082_5(AC117082|pid:none) Dictyostelium discoideum chromosom... 139 2e-31
AC115592_17(AC115592|pid:none) Dictyostelium discoideum chromoso... 138 5e-31
AF094691_1(AF094691|pid:none) Mus musculus guanine nucleotide re... 137 1e-30
AK135070_1(AK135070|pid:none) Mus musculus adult male olfactory ... 137 1e-30
X59868_1(X59868|pid:none) M.musculus CDC25Mm mRNA for guanine nu... 137 1e-30
BC091317_1(BC091317|pid:none) Rattus norvegicus RAS protein-spec... 136 2e-30
AX027844_1(AX027844|pid:none) Sequence 1 from Patent WO0040718. 134 7e-30
(P70392) RecName: Full=Ras-specific guanine nucleotide-releasing... 129 2e-28
(Q99JE4) RecName: Full=Ras-specific guanine nucleotide-releasing... 129 3e-28
AF109312_1(AF109312|pid:none) Mus musculus guanine nucleotide re... 129 4e-28
AY160105_1(AY160105|pid:none) Dictyostelium discoideum nucleotid... 128 5e-28
AF023130_1(AF023130|pid:none) Homo sapiens Ras-GRF2 mRNA, partia... 128 6e-28
CQ834804_1(CQ834804|pid:none) Sequence 675 from Patent WO2004058... 128 6e-28
(O14827) RecName: Full=Ras-specific guanine nucleotide-releasing... 128 6e-28
CR858031_1(CR858031|pid:none) Pongo abelii mRNA; cDNA DKFZp459J1... 127 8e-28
(A2CEA7) RecName: Full=Ras-specific guanine nucleotide-releasing... 127 1e-27
A75965_1(A75965|pid:none) Sequence 1 from Patent WO9321314. 126 2e-27
AB385192_1(AB385192|pid:none) Synthetic construct DNA, clone: pF... 126 2e-27
BC131870_1(BC131870|pid:none) Danio rerio zgc:158274, mRNA (cDNA... 125 3e-27
BC143367_1(BC143367|pid:none) Homo sapiens son of sevenless homo... 125 5e-27
AB209277_1(AB209277|pid:none) Homo sapiens mRNA for son of seven... 125 5e-27
A75971_1(A75971|pid:none) Sequence 7 from Patent WO9321314. 124 9e-27
L20686_1(L20686|pid:none) Homo sapiens guanine nucleotide releas... 124 9e-27
S25714(S25714) son-of-sevenless-2 protein - mouse (fragment) &Z... 123 2e-26
(Q02384) RecName: Full=Son of sevenless homolog 2; Shor... 123 2e-26
AY902349_1(AY902349|pid:none) Mus musculus strain CAST/EiJ son o... 122 3e-26
(Q62245) RecName: Full=Son of sevenless homolog 1; Shor... 122 3e-26
S25716(S25716;S21391) Ras guanine nucleotide exchange factor son... 122 3e-26
AK140310_1(AK140310|pid:none) Mus musculus adult male adrenal gl... 122 3e-26
AF094679_1(AF094679|pid:none) Mus musculus Sos1 gene, exon and p... 122 3e-26
AF441482_1(AF441482|pid:none) Homo sapiens alternate SOS1 (SOS1)... 121 6e-26
AC019171_1(AC019171|pid:none) Homo sapiens BAC clone RP11-173C1 ... 121 6e-26
(Q07889) RecName: Full=Son of sevenless homolog 1; Shor... 121 6e-26
A37488(A37488)Ras guanine nucleotide exchange factor son-of-seve... 121 6e-26
AB209140_1(AB209140|pid:none) Homo sapiens mRNA for son of seven... 121 6e-26
BT015294_1(BT015294|pid:none) Drosophila melanogaster GH01796 fu... 120 2e-25
(P26675) RecName: Full=Protein son of sevenless; &A41216(A41216... 120 2e-25
M83931_1(M83931|pid:none) Drosophila melanogaster son of sevenle... 120 2e-25
AC116987_20(AC116987|pid:none) Dictyostelium discoideum chromoso... 119 4e-25
AL031966_1(AL031966|pid:none) S.pombe chromosome III cosmid c1442. 118 5e-25
A75969_1(A75969|pid:none) Sequence 5 from Patent WO9321314. 118 6e-25
BC166138_1(BC166138|pid:none) Xenopus tropicalis Rap guanine nuc... 117 8e-25
CR382130_894(CR382130|pid:none) Yarrowia lipolytica strain CLIB1... 115 3e-24
AB385202_1(AB385202|pid:none) Synthetic construct DNA, clone: pF... 114 7e-24
BC041710_1(BC041710|pid:none) Homo sapiens Rap guanine nucleotid... 114 7e-24
AK147696_1(AK147696|pid:none) Mus musculus cDNA, RIKEN full-leng... 114 7e-24
JC7736(JC7736)C3G protein, long type - mouse 114 7e-24
BC129881_1(BC129881|pid:none) Mus musculus Rap guanine nucleotid... 114 7e-24
AK077034_1(AK077034|pid:none) Mus musculus adult male testis cDN... 114 7e-24
AK147468_1(AK147468|pid:none) Mus musculus adult male brain UNDE... 114 7e-24
AL160276_3(AL160276|pid:none) Human DNA sequence from clone RP11... 114 7e-24
AY160092_1(AY160092|pid:none) Dictyostelium discoideum nucleotid... 114 1e-23
CU633900_651(CU633900|pid:none) Podospora anserina genomic DNA c... 110 2e-22
AM920436_178(AM920436|pid:none) Penicillium chrysogenum Wisconsi... 107 1e-21
AE013599_2480(AE013599|pid:none) Drosophila melanogaster chromos... 107 1e-21
FN357308_23(FN357308|pid:none) Schistosoma mansoni genome sequen... 105 3e-21
AY254473_1(AY254473|pid:none) Dictyostelium discoideum nucleotid... 105 4e-21
(Q4R7W3) RecName: Full=Ras-specific guanine nucleotide-releasing... 104 1e-20
(Q5ZJK0) RecName: Full=Ras-specific guanine nucleotide-releasing... 104 1e-20
(Q86X27) RecName: Full=Ras-specific guanine nucleotide-releasing... 104 1e-20
AF312924_1(AF312924|pid:none) Mus musculus Ral-A exchange factor... 103 2e-20
AE014298_984(AE014298|pid:none) Drosophila melanogaster chromoso... 103 2e-20
AE014298_987(AE014298|pid:none) Drosophila melanogaster chromoso... 103 2e-20
AE014298_985(AE014298|pid:none) Drosophila melanogaster chromoso... 103 2e-20
AE014298_983(AE014298|pid:none) Drosophila melanogaster chromoso... 103 2e-20
AF053358_1(AF053358|pid:none) Drosophila melanogaster guanine nu... 103 2e-20
(O77086) RecName: Full=Guanine nucleotide-releasing factor 2; Al... 103 2e-20
BT025818_1(BT025818|pid:none) Drosophila melanogaster IP03271 fu... 103 2e-20
AK018622_1(AK018622|pid:none) Mus musculus adult male cecum cDNA... 103 2e-20
AK033549_1(AK033549|pid:none) Mus musculus adult male colon cDNA... 103 2e-20
AK029049_1(AK029049|pid:none) Mus musculus 10 days neonate skin ... 103 2e-20
AK169368_1(AK169368|pid:none) Mus musculus 17 days pregnant adul... 103 2e-20
(Q9ERD6) RecName: Full=Ras-specific guanine nucleotide-releasing... 103 2e-20
AE016817_362(AE016817|pid:none) Ashbya gossypii (= Eremothecium ... 102 3e-20
AP007162_207(AP007162|pid:none) Aspergillus oryzae RIB40 genomic... 102 3e-20
AK036803_1(AK036803|pid:none) Mus musculus adult female vagina c... 102 5e-20
AC116986_28(AC116986|pid:none) Dictyostelium discoideum chromoso... 102 5e-20
BC118719_1(BC118719|pid:none) Xenopus tropicalis hypothetical pr... 100 1e-19
CR382124_382(CR382124|pid:none) Kluyveromyces lactis strain NRRL... 97 2e-18
AK001106_1(AK001106|pid:none) Homo sapiens cDNA FLJ10244 fis, cl... 96 4e-18
AC024755_6(AC024755|pid:none) Caenorhabditis elegans cosmid Y34B... 95 6e-18
AY149915_1(AY149915|pid:none) Ustilago maydis guanyl nucleotide ... 94 1e-17
(P04821) RecName: Full=Cell division control protein 25; &GN103... 94 2e-17
BC040183_1(BC040183|pid:none) Homo sapiens Rap guanine nucleotid... 93 3e-17
AY160104_1(AY160104|pid:none) Dictyostelium discoideum nucleotid... 91 8e-17
AL845277_5(AL845277|pid:none) Mouse DNA sequence from clone RP23... 91 1e-16
(Q9USU1) RecName: Full=Ras guanine nucleotide exchange factor ef... 91 1e-16
BC032372_1(BC032372|pid:none) Homo sapiens Ral GEF with PH domai... 91 1e-16
CS416351_1(CS416351|pid:none) Sequence 3 from Patent WO200609470... 91 1e-16
AK296340_1(AK296340|pid:none) Homo sapiens cDNA FLJ58368 complet... 91 1e-16
AK304278_1(AK304278|pid:none) Homo sapiens cDNA FLJ51189 complet... 91 1e-16
BC024004_1(BC024004|pid:none) Homo sapiens Rap guanine nucleotid... 91 1e-16
AK316014_1(AK316014|pid:none) Homo sapiens cDNA, FLJ78913 comple... 91 1e-16
AB075513_1(AB075513|pid:none) Homo sapiens neuroblastoma cDNA, c... 91 1e-16
(Q8WZA2) RecName: Full=Rap guanine nucleotide exchange factor 4;... 91 1e-16
AL160169_2(AL160169|pid:none) Human DNA sequence from clone RP11... 89 3e-16
AK122234_1(AK122234|pid:none) Mus musculus mRNA for mKIAA0277 pr... 89 3e-16
AL160169_5(AL160169|pid:none) Human DNA sequence from clone RP11... 89 3e-16
(B0UXH6) RecName: Full=Ras-specific guanine nucleotide-releasing... 89 3e-16
BC146736_1(BC146736|pid:none) Danio rerio Ral GEF with PH domain... 89 3e-16
AK030016_1(AK030016|pid:none) Mus musculus adult male testis cDN... 89 3e-16
AK083591_1(AK083591|pid:none) Mus musculus 9 days embryo whole b... 89 3e-16
(Q9NZ16) RecName: Full=Ras-specific guanine nucleotide-releasing... 89 3e-16
AY160093_1(AY160093|pid:none) Dictyostelium discoideum nucleotid... 89 4e-16
CP000502_107(CP000502|pid:none) Pichia stipitis CBS 6054 chromos... 89 4e-16
S14177(S14177;S12942;PS0040)SCD25 protein (version 1) - yeast (S... 89 5e-16
BC072656_1(BC072656|pid:none) Mus musculus Ral GEF with PH domai... 88 7e-16
AK299149_1(AK299149|pid:none) Homo sapiens cDNA FLJ61342 complet... 88 7e-16
BC055185_1(BC055185|pid:none) Danio rerio Ral-A exchange factor ... 88 7e-16
GN110865_1(GN110865|pid:none) Sequence 15646 from Patent WO20090... 88 9e-16
CU928180_398(CU928180|pid:none) Kluyveromyces thermotolerans str... 88 9e-16
(P14771) RecName: Full=Guanine nucleotide exchange factor SDC25; 88 9e-16
AY582133_1(AY582133|pid:none) Xenopus laevis Rap1 guanine-nucleo... 88 9e-16
M26647_1(M26647|pid:none) Saccharomyces cerevisiae SDC25 gene, c... 88 9e-16
GN103733_1(GN103733|pid:none) Sequence 8514 from Patent WO200903... 88 9e-16
AF321469_1(AF321469|pid:none) Yarrowia lipolytica Ras guanine-nu... 88 9e-16
AK220281_1(AK220281|pid:none) Mus musculus mRNA for mKIAA4040 pr... 87 1e-15
(Q9EQZ6) RecName: Full=Rap guanine nucleotide exchange factor 4;... 87 1e-15
AB445011_1(AB445011|pid:none) Mus musculus cAMP-GEFII mRNA for c... 87 1e-15
AB037668_1(AB037668|pid:none) Mus musculus Epac2 mRNA for cAMP-G... 87 1e-15
FN357603_14(FN357603|pid:none) Schistosoma mansoni genome sequen... 87 2e-15
AK029995_1(AK029995|pid:none) Mus musculus adult male testis cDN... 87 2e-15
(P83900) RecName: Full=Rap guanine nucleotide exchange factor 5;... 87 2e-15
AK143331_1(AK143331|pid:none) Mus musculus 2 days pregnant adult... 86 3e-15
BC025553_1(BC025553|pid:none) Mus musculus Rap guanine nucleotid... 86 3e-15
(Q3UYI5) RecName: Full=Ral guanine nucleotide dissociation stimu... 86 3e-15
AC024755_7(AC024755|pid:none) Caenorhabditis elegans cosmid Y34B... 86 3e-15
AL607091_5(AL607091|pid:none) Mouse DNA sequence from clone RP23... 86 3e-15
AL607091_4(AL607091|pid:none) Mouse DNA sequence from clone RP23... 86 3e-15
AL596127_16(AL596127|pid:none) Mouse DNA sequence from clone RP2... 86 3e-15
AC074344_1(AC074344|pid:none) Homo sapiens BAC clone RP11-138A23... 85 6e-15
(Q9Z1C7) RecName: Full=Rap guanine nucleotide exchange factor 4;... 85 6e-15
AK294459_1(AK294459|pid:none) Homo sapiens cDNA FLJ61094 partial... 85 6e-15
AB002311_1(AB002311|pid:none) Homo sapiens mRNA for KIAA0313 gen... 85 6e-15
AF251308_1(AF251308|pid:none) Caenorhabditis elegans guanine nuc... 85 8e-15
AC006692_9(AC006692|pid:none) Caenorhabditis elegans cosmid T28F... 85 8e-15
D87467_1(D87467|pid:none) Homo sapiens mRNA for KIAA0277 gene, p... 85 8e-15
BC124563_1(BC124563|pid:none) Xenopus tropicalis hypothetical pr... 85 8e-15
CR380950_274(CR380950|pid:none) Candida glabrata strain CBS138 c... 84 1e-14
AF478567_1(AF478567|pid:none) Homo sapiens PDZ domain-containing... 83 2e-14
AK302640_1(AK302640|pid:none) Homo sapiens cDNA FLJ53249 complet... 83 2e-14
BC144627_1(BC144627|pid:none) Homo sapiens Rap guanine nucleotid... 83 2e-14
BX004769_1(BX004769|pid:none) Zebrafish DNA sequence from clone ... 83 2e-14
AF394782_1(AF394782|pid:none) Homo sapiens rap guanine nucleotid... 83 2e-14
AE013599_215(AE013599|pid:none) Drosophila melanogaster chromoso... 83 3e-14
AE013599_216(AE013599|pid:none) Drosophila melanogaster chromoso... 83 3e-14
BC143530_1(BC143530|pid:none) Homo sapiens ral guanine nucleotid... 82 4e-14
AK074082_1(AK074082|pid:none) Homo sapiens mRNA for FLJ00153 pro... 82 4e-14
AF170796_1(AF170796|pid:none) Caenorhabditis elegans RA-GEF (ra-... 82 5e-14
FM992690_366(FM992690|pid:none) Candida dubliniensis CD36 chromo... 82 5e-14
AF308449_1(AF308449|pid:none) Caenorhabditis elegans PXF isoform... 82 5e-14
BC125684_1(BC125684|pid:none) Xenopus tropicalis Rap guanine nuc... 82 5e-14
AM269957_6(AM269957|pid:none) Aspergillus niger contig An01c0100... 82 5e-14
AE017356_184(AE017356|pid:none) Cryptococcus neoformans var. neo... 81 9e-14
(P43069) RecName: Full=Cell division control protein 25; &GN103... 81 1e-13
AL669999_10(AL669999|pid:none) Neurospora crassa DNA linkage gro... 81 1e-13
BT010019_1(BT010019|pid:none) Drosophila melanogaster RE10624 fu... 79 3e-13
AM920437_1749(AM920437|pid:none) Penicillium chrysogenum Wiscons... 79 6e-13
AL845277_3(AL845277|pid:none) Mouse DNA sequence from clone RP23... 78 7e-13
AK129123_1(AK129123|pid:none) Mus musculus mRNA for mKIAA0351 pr... 78 7e-13
AP007157_830(AP007157|pid:none) Aspergillus oryzae RIB40 genomic... 77 1e-12
AM270066_3(AM270066|pid:none) Aspergillus niger contig An04c0050... 77 1e-12
EF636666_1(EF636666|pid:none) Canis lupus familiaris exchange pr... 77 2e-12
CR749239_1(CR749239|pid:none) Homo sapiens mRNA; cDNA DKFZp781H1... 77 2e-12
AK034265_1(AK034265|pid:none) Mus musculus adult male diencephal... 77 2e-12
BC020311_1(BC020311|pid:none) Mus musculus Rap guanine nucleotid... 77 2e-12
AK142594_1(AK142594|pid:none) Mus musculus 10 days lactation, ad... 77 2e-12
CS416355_1(CS416355|pid:none) Sequence 7 from Patent WO2006094703. 76 3e-12
BC017728_1(BC017728|pid:none) Homo sapiens Rap guanine nucleotid... 76 3e-12
AK125545_1(AK125545|pid:none) Homo sapiens cDNA FLJ43557 fis, cl... 76 3e-12
(O95398) RecName: Full=Rap guanine nucleotide exchange factor 3;... 76 3e-12
BC092404_1(BC092404|pid:none) Homo sapiens Rap guanine nucleotid... 76 3e-12
EU362913_1(EU362913|pid:none) Drosophila melanogaster dizzy isof... 75 5e-12
AE014134_1119(AE014134|pid:none) Drosophila melanogaster chromos... 75 5e-12
EU362915_1(EU362915|pid:none) Drosophila melanogaster dizzy isof... 75 5e-12
FM992695_606(FM992695|pid:none) Candida dubliniensis CD36 chromo... 73 3e-11
FN357914_21(FN357914|pid:none) Schistosoma mansoni genome sequen... 73 3e-11
BX571854_2(BX571854|pid:none) Zebrafish DNA sequence from clone ... 72 5e-11
AK295611_1(AK295611|pid:none) Homo sapiens cDNA FLJ50530 complet... 71 9e-11
BC020532_1(BC020532|pid:none) Mus musculus Rap guanine nucleotid... 71 1e-10
(Q8VCC8) RecName: Full=Rap guanine nucleotide exchange factor 3;... 71 1e-10
AJ720654_1(AJ720654|pid:none) Gallus gallus mRNA for hypothetica... 70 2e-10
AB154824_1(AB154824|pid:none) Mus musculus mRNA for RasGRP3, com... 70 3e-10
AK316526_1(AK316526|pid:none) Homo sapiens cDNA, FLJ79425 comple... 69 3e-10
AL590422_1(AL590422|pid:none) Human DNA sequence from clone RP11... 69 3e-10
AF186798_1(AF186798|pid:none) Homo sapiens RalGDS-like (RGL) gen... 69 3e-10
AK295179_1(AK295179|pid:none) Homo sapiens cDNA FLJ50518 complet... 69 3e-10
AF186798_2(AF186798|pid:none) Homo sapiens RalGDS-like (RGL) gen... 69 3e-10
BC139712_1(BC139712|pid:none) Danio rerio similar to Ral guanine... 69 5e-10
CU638743_770(CU638743|pid:none) Podospora anserina genomic DNA c... 69 5e-10
(Q9UHV5) RecName: Full=Rap guanine nucleotide exchange factor-li... 69 6e-10
AK304160_1(AK304160|pid:none) Homo sapiens cDNA FLJ56384 complet... 69 6e-10
AF117946_1(AF117946|pid:none) Homo sapiens Link guanine nucleoti... 69 6e-10
(Q5R9B2) RecName: Full=Rap guanine nucleotide exchange factor-li... 69 6e-10
AE017353_159(AE017353|pid:none) Cryptococcus neoformans var. neo... 69 6e-10
AK294642_1(AK294642|pid:none) Homo sapiens cDNA FLJ58529 complet... 69 6e-10
AK144218_1(AK144218|pid:none) Mus musculus CRL-2116 JC cDNA, RIK... 68 8e-10
AL590963_1(AL590963|pid:none) Mouse DNA sequence from clone RP23... 68 1e-09
BC080279_1(BC080279|pid:none) Mus musculus Rap guanine nucleotid... 68 1e-09
AK292983_1(AK292983|pid:none) Homo sapiens cDNA FLJ77595 complet... 67 1e-09
AK173041_1(AK173041|pid:none) Mus musculus mRNA for mKIAA0846 pr... 67 2e-09
AL845277_2(AL845277|pid:none) Mouse DNA sequence from clone RP23... 66 3e-09
AB384012_1(AB384012|pid:none) Synthetic construct DNA, clone: pF... 66 4e-09
AJ720845_1(AJ720845|pid:none) Gallus gallus mRNA for hypothetica... 66 4e-09
BC155690_1(BC155690|pid:none) Xenopus tropicalis hypothetical pr... 66 4e-09
(Q8IV61) RecName: Full=Ras guanyl-releasing protein 3; AltName: ... 66 4e-09
BC119832_1(BC119832|pid:none) Bos taurus RAS guanyl releasing pr... 65 8e-09
AK299029_1(AK299029|pid:none) Homo sapiens cDNA FLJ56134 complet... 65 8e-09
AK314091_1(AK314091|pid:none) Homo sapiens cDNA, FLJ94771, highl... 63 2e-08
(Q9UI94) RecName: Full=RAS guanyl-releasing protein 1; AltName: ... 63 2e-08
AY858556_1(AY858556|pid:none) Homo sapiens RAS guanyl releasing ... 63 2e-08
(Q55EC7) RecName: Full=RasGEF domain-containing serine/threonine... 63 2e-08
AY954625_1(AY954625|pid:none) Homo sapiens Ras guanyl releasing ... 63 2e-08
(A4IJ06) RecName: Full=RAS guanyl-releasing protein 1; &BC13622... 63 2e-08
AK169430_1(AK169430|pid:none) Mus musculus 17 days pregnant adul... 63 3e-08
AK159754_1(AK159754|pid:none) Mus musculus osteoclast-like cell ... 62 4e-08
AK149644_1(AK149644|pid:none) Mus musculus bone marrow macrophag... 62 4e-08
AF081197_1(AF081197|pid:none) Homo sapiens calcium and DAG-regul... 62 4e-08
BC149035_1(BC149035|pid:none) Bos taurus ral guanine nucleotide ... 62 4e-08
AL772249_10(AL772249|pid:none) Mouse DNA sequence from clone RP2... 62 4e-08
BC161641_1(BC161641|pid:none) Xenopus tropicalis hypothetical pr... 62 4e-08
CR382137_925(CR382137|pid:none) Debaryomyces hansenii strain CBS... 62 4e-08
AK141959_1(AK141959|pid:none) Mus musculus 12 days embryo spinal... 62 4e-08
AF081195_1(AF081195|pid:none) Homo sapiens calcium and DAG-regul... 62 4e-08
AK141524_1(AK141524|pid:none) Mus musculus adult male hippocampu... 61 9e-08
AF060819_1(AF060819|pid:none) Rattus norvegicus ras guanyl relea... 60 2e-07
(Q9R1K8) RecName: Full=RAS guanyl-releasing protein 1; AltName: ... 60 2e-07
CR382123_145(CR382123|pid:none) Kluyveromyces lactis strain NRRL... 60 2e-07
(Q6NTL4) RecName: Full=RAS guanyl-releasing protein 1; &BC06894... 60 2e-07
(Q8IZJ4) RecName: Full=Ral-GDS-related protein; Short=h... 60 2e-07
AB208848_1(AB208848|pid:none) Homo sapiens mRNA for Ras activato... 60 3e-07
AF027169_1(AF027169|pid:none) Homo sapiens Ral guanine nucleotid... 60 3e-07
AB037729_1(AB037729|pid:none) Homo sapiens mRNA for KIAA1308 pro... 60 3e-07
AK056462_1(AK056462|pid:none) Homo sapiens cDNA FLJ31900 fis, cl... 60 3e-07
AK074114_1(AK074114|pid:none) Homo sapiens mRNA for FLJ00185 pro... 60 3e-07
AK301470_1(AK301470|pid:none) Homo sapiens cDNA FLJ53221 complet... 60 3e-07
AK127524_1(AK127524|pid:none) Homo sapiens cDNA FLJ45617 fis, cl... 60 3e-07
AK293997_1(AK293997|pid:none) Homo sapiens cDNA FLJ55326 complet... 60 3e-07
AY810144_1(AY810144|pid:none) Schistosoma japonicum SJCHGC07188 ... 60 3e-07
(Q03385) RecName: Full=Ral guanine nucleotide dissociation stimu... 59 4e-07
BC005037_1(BC005037|pid:none) Homo sapiens ral guanine nucleotid... 59 5e-07
(O15211) RecName: Full=Ral guanine nucleotide dissociation stimu... 59 5e-07
(Q03386) RecName: Full=Ral guanine nucleotide dissociation stimu... 59 6e-07
AC117080_21(AC117080|pid:none) Dictyostelium discoideum chromoso... 58 8e-07
BX640472_3(BX640472|pid:none) Zebrafish DNA sequence from clone ... 58 8e-07
AY160103_1(AY160103|pid:none) Dictyostelium discoideum nucleotid... 58 8e-07
T21321(T21321)hypothetical protein F25B3.3 - Caenorhabditis eleg... 56 4e-06
BC101108_1(BC101108|pid:none) Homo sapiens ral guanine nucleotid... 56 4e-06
BC101110_1(BC101110|pid:none) Homo sapiens ral guanine nucleotid... 56 4e-06
U68142_1(U68142|pid:none) Human RalGDS-like 2 (RGL2) mRNA, parti... 56 4e-06
Z70752_2(Z70752|pid:none) Caenorhabditis elegans Cosmid F25B3, c... 55 5e-06
BC101109_1(BC101109|pid:none) Homo sapiens ral guanine nucleotid... 55 5e-06
AF032126_1(AF032126|pid:none) Drosophila melanogaster ral guanin... 55 9e-06
AE014296_2462(AE014296|pid:none) Drosophila melanogaster chromos... 55 9e-06
AE014296_2459(AE014296|pid:none) Drosophila melanogaster chromos... 55 9e-06
AK304293_1(AK304293|pid:none) Homo sapiens cDNA FLJ52394 complet... 54 1e-05
AM989988_10(AM989988|pid:none) Zygosaccharomyces rouxii strain C... 54 1e-05
AY160095_1(AY160095|pid:none) Dictyostelium discoideum nucleotid... 53 3e-05
BT044818_1(BT044818|pid:none) Salmo salar clone ssal-rgf-504-236... 53 3e-05
AK096811_1(AK096811|pid:none) Homo sapiens cDNA FLJ39492 fis, cl... 53 3e-05
AK028308_1(AK028308|pid:none) Mus musculus adult male brain cDNA... 50 2e-04
BC040275_1(BC040275|pid:none) Homo sapiens Ras protein-specific ... 50 2e-04
AE016819_863(AE016819|pid:none) Ashbya gossypii (= Eremothecium ... 49 5e-04
BC110306_1(BC110306|pid:none) Homo sapiens RAS guanyl releasing ... 49 6e-04
AK092882_1(AK092882|pid:none) Homo sapiens cDNA FLJ35563 fis, cl... 49 6e-04
AF043722_1(AF043722|pid:none) Homo sapiens guanine exchange fact... 49 6e-04
AF081193_1(AF081193|pid:none) Mus musculus calcium and DAG-regul... 48 8e-04
(P0C643) RecName: Full=RAS guanyl-releasing protein 2; AltName: ... 48 8e-04
(A6N9I4) RecName: Full=RAS guanyl-releasing protein 2; AltName: ... 48 0.001
BC033198_1(BC033198|pid:none) Homo sapiens, clone IMAGE:4852125,... 47 0.002
(Q9QUG9) RecName: Full=RAS guanyl-releasing protein 2; AltName: ... 47 0.002
U42834_3(U42834|pid:none) Caenorhabditis elegans cosmid F28B4, c... 46 0.003
BX284747_19(BX284747|pid:none) Neurospora crassa DNA linkage gro... 46 0.003
(Q8MVR1) RecName: Full=Cyclic GMP-binding protein C; EC... 45 0.005
CR380948_48(CR380948|pid:none) Candida glabrata strain CBS138 ch... 45 0.009
DQ246664_3(DQ246664|pid:none) Oncorhynchus mykiss SYPG1 (SYPG1),... 44 0.016
BX908798_1363(BX908798|pid:none) Parachlamydia-related symbiont ... 43 0.035
AY365418_10(AY365418|pid:none) Epichloe festucae strain 1035.30 ... 42 0.045
CR382131_1446(CR382131|pid:none) Yarrowia lipolytica strain CLIB... 40 0.29
AE014296_3925(AE014296|pid:none) Drosophila melanogaster chromos... 40 0.29
M68938_1(M68938|pid:none) Yeast (BUD5) gene, complete cds. 39 0.38
(P25300) RecName: Full=Bud site selection protein 5; &X59720_11... 39 0.38
X63853_1(X63853|pid:none) S.cerevisiae MAT locus genes BUD5, mat... 39 0.38
AK290135_1(AK290135|pid:none) Homo sapiens cDNA FLJ77032 partial... 39 0.38
X56909_5(X56909|pid:none) S.cerevisiae 8.2 kb segment left of MAT. 39 0.38
AK301205_1(AK301205|pid:none) Homo sapiens cDNA FLJ50071 complet... 39 0.38
FN357907_3(FN357907|pid:none) Schistosoma mansoni genome sequenc... 39 0.65
U82163_1(U82163|pid:none) Oryctolagus cuniculus oncogene rsc mRN... 38 0.85
CU928174_466(CU928174|pid:none) Zygosaccharomyces rouxii strain ... 38 1.1
AK302825_1(AK302825|pid:none) Homo sapiens cDNA FLJ56976 complet... 37 1.5
CU928180_310(CU928180|pid:none) Kluyveromyces thermotolerans str... 37 1.5
AK131340_1(AK131340|pid:none) Homo sapiens cDNA FLJ16354 fis, cl... 37 1.9
CR861270_1(CR861270|pid:none) Pongo abelii mRNA; cDNA DKFZp459K0... 37 1.9
(A0JM95) RecName: Full=Ras-GEF domain-containing family member 1... 37 2.5
AM167904_534(AM167904|pid:none) Bordetella avium 197N complete g... 37 2.5
CP001081_192(CP001081|pid:none) Clostridium botulinum Ba4 str. 6... 36 3.2
CP000963_275(CP000963|pid:none) Clostridium botulinum A3 str. Lo... 36 4.2
AP008230_3036(AP008230|pid:none) Desulfitobacterium hafniense Y5... 36 4.2
AM920433_156(AM920433|pid:none) Penicillium chrysogenum Wisconsi... 36 4.2
>AF275723_1(AF275723|pid:none) Dictyostelium discoideum Ras guanine
nucleotide exchange factor RasGEFB (gefB) mRNA, complete
cds.
Length = 1529
Score = 493 bits (1268), Expect = e-137
Identities = 247/274 (90%), Positives = 247/274 (90%)
Frame = +3
Query: 618 LPIINNGQGIPKAKIFWMKYSTEFIFSQSSTDIAEQLTLLDFDSYKSIEEIELLNQAWSK 797
LPIINNGQGIPKAKIFWMKYSTEFIFSQSSTDIAEQLTLLDFDSYKSIEEIELLNQAWSK
Sbjct: 1254 LPIINNGQGIPKAKIFWMKYSTEFIFSQSSTDIAEQLTLLDFDSYKSIEEIELLNQAWSK 1313
Query: 798 PDQKTNTPNIAXXXXXXXXXXXXXXWAILRENDIKQRSKMMLKMIKICYALYKLSNFNXX 977
PDQKTNTPNIA WAILRENDIKQRSKMMLKMIKICYALYKLSNFN
Sbjct: 1314 PDQKTNTPNIASMVNRFNSFSSFVSWAILRENDIKQRSKMMLKMIKICYALYKLSNFNGL 1373
Query: 978 XXXXXXXXXXXVYRLNHTKSLISKQYQKKFDFLCKFLDTKKSHKVYRDIIHSTCPPLIPY 1157
VYRLNHTKSLISKQYQKKFDFLCKFLDTKKSHKVYRDIIHSTCPPLIPY
Sbjct: 1374 LAGLSGLMASGVYRLNHTKSLISKQYQKKFDFLCKFLDTKKSHKVYRDIIHSTCPPLIPY 1433
Query: 1158 LGIYLTDLTFIEDGNQDEIKGLINFKKREMIFNTILEIQQYQQQGYTIKPKPSVLGFLCE 1337
LGIYLTDLTFIEDGNQDEIKGLINFKKREMIFNTILEIQQYQQQGYTIKPKPSVLGFLCE
Sbjct: 1434 LGIYLTDLTFIEDGNQDEIKGLINFKKREMIFNTILEIQQYQQQGYTIKPKPSVLGFLCE 1493
Query: 1338 LPHMSDKKKFEDDTYEQSILLEPKNSTKLEVMNA 1439
LPHMSDKKKFEDDTYEQSILLEPKNSTKLEVMNA
Sbjct: 1494 LPHMSDKKKFEDDTYEQSILLEPKNSTKLEVMNA 1527
Score = 317 bits (813), Expect = 6e-85
Identities = 165/201 (82%), Positives = 165/201 (82%)
Frame = +3
Query: 3 REYXXXXXXXXXXXXXXVMINNRSIGKSFSTGNFSQPQPIMPSXXXXXXXXXXXXXXXXX 182
REY VMINNRSIGKSFSTGNFSQPQPIMPS
Sbjct: 948 REYNHSHHHLLSSSSNNVMINNRSIGKSFSTGNFSQPQPIMPSNGIGGSGGGGLGTTLSV 1007
Query: 183 XXXXIVGGLQSRSSSFEENQLQYAIESFMEVYNHLTSKDKVDTSIWLEEEKEDINVYYIN 362
IVGGLQSRSSSFEENQLQYAIESFMEVYNHLTSKDKVDTSIWLEEEKEDINVYYIN
Sbjct: 1008 GNGGIVGGLQSRSSSFEENQLQYAIESFMEVYNHLTSKDKVDTSIWLEEEKEDINVYYIN 1067
Query: 363 NTNIDDKFYRSIKYASLNQLILKLTCESNTELRFTKTFITTYRSFTTGDIFLMKLIQRYF 542
NTNID KFYRSIKYASLNQLILKLTCESNTELRFTKTFITTYRSFTTGDIFLMKLIQRYF
Sbjct: 1068 NTNIDGKFYRSIKYASLNQLILKLTCESNTELRFTKTFITTYRSFTTGDIFLMKLIQRYF 1127
Query: 543 TPNLKNIVPYQFVQKIQIPIQ 605
TPNLKNIVPYQFVQKIQIPIQ
Sbjct: 1128 TPNLKNIVPYQFVQKIQIPIQ 1148
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3236559
Number of Hits to DB: 1,958,038,928
Number of extensions: 35352532
Number of successful extensions: 91887
Number of sequences better than 10.0: 307
Number of HSP's gapped: 91121
Number of HSP's successfully gapped: 384
Length of query: 503
Length of database: 1,051,180,864
Length adjustment: 133
Effective length of query: 370
Effective length of database: 620,718,517
Effective search space: 229665851290
Effective search space used: 229665851290
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)
Dictyostelium discoideum cDNA Project Home