Homology VSG621 vs Protein
Query= VSG621 (VSG621Q) /CSM/VS/VSG6-A/VSG621Q.Seq.d/
(504 letters)
Database: nrp_B
5,349,213 sequences; 1,732,582,204 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
(O81983) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 120 2e-26
CU640366_559(CU640366|pid:none) Podospora anserina S mat+ genomi... 118 1e-25
CP001325_405(CP001325|pid:none) Micromonas sp. RCC299 chromosome... 117 2e-25
GN111888_1(GN111888|pid:none) Sequence 16669 from Patent WO20090... 117 3e-25
BT039662_1(BT039662|pid:none) Zea mays full-length cDNA clone ZM... 116 4e-25
CP003009_637(CP003009|pid:none) Thielavia terrestris NRRL 8126 c... 116 5e-25
BT039312_1(BT039312|pid:none) Zea mays full-length cDNA clone ZM... 115 7e-25
CR380957_498(CR380957|pid:none) Candida glabrata strain CBS138 c... 114 2e-24
AK059522_1(AK059522|pid:none) Oryza sativa Japonica Group cDNA c... 113 3e-24
AK069764_1(AK069764|pid:none) Oryza sativa Japonica Group cDNA c... 113 3e-24
AJ007665_1(AJ007665|pid:none) Zea mays mRNA for cytosolic seryl-... 112 6e-24
BX294023_18(BX294023|pid:none) Neurospora crassa DNA linkage gro... 111 1e-23
X04884_1(X04884|pid:none) Yeast serS gene for seryl-tRNA synthet... 110 3e-23
FN393063_227(FN393063|pid:none) Saccharomyces cerevisiae EC1118 ... 110 3e-23
AE016815_124(AE016815|pid:none) Ashbya gossypii ATCC 10895 chrom... 110 3e-23
HE576752_1024(HE576752|pid:none) Naumovozyma castellii CBS 4309 ... 109 6e-23
CP000588_188(CP000588|pid:none) Ostreococcus lucimarinus CCE9901... 107 2e-22
CP003003_597(CP003003|pid:none) Myceliophthora thermophila ATCC ... 107 2e-22
CR382132_109(CR382132|pid:none) Yarrowia lipolytica strain CLIB1... 104 2e-21
CU928167_329(CU928167|pid:none) Kluyveromyces thermotolerans str... 103 4e-21
CR954208_197(CR954208|pid:none) Ostreococcus tauri strain OTTH05... 100 4e-20
FJ362380_1(FJ362380|pid:none) Caenorhabditis sp. PS1010 contig J... 100 5e-20
HE580267_570(HE580267|pid:none) Naumovozyma dairenensis CBS 421 ... 99 7e-20
CR382121_442(CR382121|pid:none) Kluyveromyces lactis strain NRRL... 98 1e-19
AL844506_173(AL844506|pid:none) Plasmodium falciparum 3D7 chromo... 98 2e-19
AM920435_49(AM920435|pid:none) Penicillium chrysogenum Wisconsin... 96 6e-19
BT127419_1(BT127419|pid:none) Dendroctonus ponderosae clone DPO1... 95 1e-18
FQ857222_32(FQ857222|pid:none) Piriformospora indica PIRI_contig... 94 3e-18
JI168996_1(JI168996|pid:none) TSA: Ascaris suum ASCF_3630_2067 m... 94 3e-18
AP003443_29(AP003443|pid:none) Oryza sativa Japonica Group genom... 94 4e-18
FM992690_262(FM992690|pid:none) Candida dubliniensis CD36 chromo... 93 6e-18
(Q9HGT6) RecName: Full=Seryl-tRNA synthetase, cytoplasmic; ... 92 8e-18
CP000498_598(CP000498|pid:none) Scheffersomyces stipitis CBS 605... 91 2e-17
CR382139_73(CR382139|pid:none) Debaryomyces hansenii strain CBS7... 91 3e-17
CP000294_100(CP000294|pid:none) Cryptococcus gattii WM276 chromo... 89 1e-16
AE017344_540(AE017344|pid:none) Cryptococcus neoformans var. neo... 88 2e-16
FQ311441_38(FQ311441|pid:none) Sporisorium reilianum SRZ2 chromo... 88 2e-16
FP929138_902(FP929138|pid:none) Leptosphaeria maculans JN3 lm_Su... 88 2e-16
(Q18678) RecName: Full=Probable seryl-tRNA synthetase, cytoplasm... 87 3e-16
GN101073_1(GN101073|pid:none) Sequence 5854 from Patent WO200903... 86 6e-16
BC067920_1(BC067920|pid:none) Xenopus tropicalis seryl-aminoacyl... 85 1e-15
AK222677_1(AK222677|pid:none) Homo sapiens mRNA for seryl-tRNA s... 85 1e-15
BC009390_1(BC009390|pid:none) Homo sapiens seryl-tRNA synthetase... 85 1e-15
AL356389_4(AL356389|pid:none) Human DNA sequence from clone RP11... 85 1e-15
(P49591) RecName: Full=Seryl-tRNA synthetase, cytoplasmic; ... 85 1e-15
(Q4R4U9) RecName: Full=Seryl-tRNA synthetase, cytoplasmic; ... 85 2e-15
JF417988_1(JF417988|pid:none) Helicoverpa armigera seryl-tRNA sy... 84 2e-15
(Q9GMB8) RecName: Full=Seryl-tRNA synthetase, cytoplasmic; ... 84 3e-15
AJ719509_1(AJ719509|pid:none) Gallus gallus mRNA for hypothetica... 83 5e-15
CP000678_1710(CP000678|pid:none) Methanobrevibacter smithii ATCC... 83 6e-15
M74012_1(M74012|pid:none) Mus musculus transfer RNA-Ser syntheta... 82 8e-15
A41019(A41019)serine-tRNA ligase (EC 6.1.1.11) - mouse (fragment) 82 8e-15
AK082793_1(AK082793|pid:none) Mus musculus ES cells cDNA, RIKEN ... 82 1e-14
AK152150_1(AK152150|pid:none) Mus musculus bone marrow macrophag... 82 1e-14
(P26638) RecName: Full=Seryl-tRNA synthetase, cytoplasmic; ... 82 1e-14
AK153158_1(AK153158|pid:none) Mus musculus bone marrow macrophag... 82 1e-14
(B9E909) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 80 5e-14
(Q2NEU9) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 78 2e-13
CP002431_2957(CP002431|pid:none) Desulfovibrio aespoeensis Aspo-... 77 3e-13
CP001899_179(CP001899|pid:none) Ferroglobus placidus DSM 10642, ... 77 4e-13
FN357431_15(FN357431|pid:none) Schistosoma mansoni genome sequen... 75 1e-12
(C5CGC3) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 75 1e-12
FN320171_1(FN320171|pid:none) Schistosoma japonicum isolate Anhu... 74 4e-12
FN315066_1(FN315066|pid:none) Schistosoma japonicum isolate Anhu... 74 4e-12
FN320167_1(FN320167|pid:none) Schistosoma japonicum isolate Anhu... 74 4e-12
AY810586_1(AY810586|pid:none) Schistosoma japonicum SJCHGC08432 ... 74 4e-12
HE573027_753(HE573027|pid:none) Trypanosoma vivax Y486 annotated... 73 5e-12
CP002772_405(CP002772|pid:none) Methanobacterium sp. SWAN-1, com... 73 7e-12
FN320168_1(FN320168|pid:none) Schistosoma japonicum isolate Anhu... 72 9e-12
(Q4A172) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 72 1e-11
CP002588_232(CP002588|pid:none) Archaeoglobus veneficus SNP6, co... 72 1e-11
(B8FXX3) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 71 3e-11
EU957812_1(EU957812|pid:none) Zea mays clone 1624285 unknown mRNA. 70 4e-11
CP002728_234(CP002728|pid:none) Tepidanaerobacter sp. Re1, compl... 70 4e-11
CP002991_28(CP002991|pid:none) Thermoanaerobacter wiegelii Rt8.B... 70 6e-11
CP002551_2191(CP002551|pid:none) Methanobacterium sp. AL-21, com... 70 6e-11
CP002372_1113(CP002372|pid:none) Thermococcus barophilus MP, com... 70 6e-11
CP001727_14(CP001727|pid:none) Alicyclobacillus acidocaldarius s... 69 7e-11
CP002739_27(CP002739|pid:none) Thermoanaerobacterium xylanolytic... 69 7e-11
CP002902_16(CP002902|pid:none) Alicyclobacillus acidocaldarius s... 69 7e-11
GM015512_203(GM015512|pid:none) Sequence 342 from Patent EP19234... 69 1e-10
(Q8RDJ5) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 69 1e-10
(Q5JE75) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 69 1e-10
AP011708_27(AP011708|pid:none) Candidatus Caldiarchaeum subterra... 69 1e-10
CP002439_2442(CP002439|pid:none) Staphylococcus pseudintermedius... 68 2e-10
CP001837_2471(CP001837|pid:none) Staphylococcus lugdunensis HKU0... 68 2e-10
CP002478_10(CP002478|pid:none) Staphylococcus pseudintermedius E... 68 2e-10
AL672200_7(AL672200|pid:none) Mouse DNA sequence from clone RP23... 68 2e-10
AL672200_6(AL672200|pid:none) Mouse DNA sequence from clone RP23... 68 2e-10
(C6BS43) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 68 2e-10
(C6A4A3) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 68 2e-10
(B0K0Z5) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 67 3e-10
FR799564_10(FR799564|pid:none) Leishmania mexicana MHOM/GT/2001/... 67 4e-10
CP002683_2098(CP002683|pid:none) Thermodesulfatator indicus DSM ... 67 5e-10
CT005250_10(CT005250|pid:none) Leishmania major strain Friedlin ... 67 5e-10
(C5A226) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 67 5e-10
(A5IMJ4) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 66 6e-10
(A3DI04) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 66 6e-10
AM502229_10(AM502229|pid:none) Leishmania infantum chromosome 11... 66 6e-10
FR799598_10(FR799598|pid:none) Leishmania donovani BPK282A1 comp... 66 6e-10
CP002779_921(CP002779|pid:none) Pyrococcus yayanosii CH1, comple... 66 8e-10
(Q65PL0) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 66 8e-10
FP929055_218(FP929055|pid:none) Ruminococcus torques L2-14 draft... 66 8e-10
BT054336_1(BT054336|pid:none) Zea mays full-length cDNA clone ZM... 66 8e-10
(Q4LAK8) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 66 8e-10
AM494956_22(AM494956|pid:none) Leishmania braziliensis chromosom... 66 8e-10
(A7HN78) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 65 1e-09
(Q6GKT6) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 65 1e-09
CP002032_43(CP002032|pid:none) Thermoanaerobacter mathranii subs... 65 1e-09
(Q9UZ21) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 65 1e-09
CP002304_23(CP002304|pid:none) Halanaerobium hydrogeniformans, c... 65 1e-09
(A6QD48) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 65 1e-09
CP000505_407(CP000505|pid:none) Thermofilum pendens Hrk 5, compl... 65 1e-09
(A5INQ0) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 65 1e-09
CP002467_941(CP002467|pid:none) Terriglobus saanensis SP1PR4, co... 65 1e-09
(A9A4V3) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 64 2e-09
CP002606_1103(CP002606|pid:none) Hippea maritima DSM 10411, comp... 64 2e-09
CP002351_1653(CP002351|pid:none) Thermotoga thermarum DSM 5069, ... 64 3e-09
CP002131_169(CP002131|pid:none) Thermosediminibacter oceani DSM ... 64 3e-09
BA000001_736(BA000001|pid:none) Pyrococcus horikoshii OT3 DNA, c... 64 3e-09
CP001945_65(CP001945|pid:none) Encephalitozoon intestinalis ATCC... 64 3e-09
(B1LBU6) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 64 3e-09
(O58441) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 64 3e-09
CP002114_9(CP002114|pid:none) Staphylococcus aureus subsp. aureu... 64 4e-09
EU976841_1(EU976841|pid:none) Zea mays clone 991581 hypothetical... 64 4e-09
CP002770_12(CP002770|pid:none) Desulfotomaculum kuznetsovii DSM ... 63 5e-09
CP001708_570(CP001708|pid:none) Anaerococcus prevotii DSM 20548,... 63 5e-09
HQ622684_1(HQ622684|pid:none) Bacillus sp. 15.4 seryl-tRNA synth... 63 7e-09
FP929044_2140(FP929044|pid:none) Eubacterium siraeum 70/3 draft ... 63 7e-09
(B9MQM8) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 63 7e-09
(A7GJT0) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 63 7e-09
CP002171_27(CP002171|pid:none) Thermoanaerobacterium thermosacch... 63 7e-09
CP002175_21(CP002175|pid:none) Halanaerobium praevalens DSM 2228... 62 9e-09
CP002839_1046(CP002839|pid:none) Halopiger xanaduensis SH-6, com... 62 9e-09
CP002216_664(CP002216|pid:none) Caldicellulosiruptor owensensis ... 62 1e-08
CP002736_20(CP002736|pid:none) Desulfotomaculum carboxydivorans ... 62 1e-08
CP003001_1614(CP003001|pid:none) Caldicellulosiruptor lactoaceti... 62 1e-08
(B1VP80) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 62 2e-08
(Q6GD81) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 62 2e-08
(A5VHP5) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 62 2e-08
CP002547_9(CP002547|pid:none) Syntrophobotulus glycolicus DSM 82... 62 2e-08
CP002844_1235(CP002844|pid:none) Lactobacillus reuteri SD2112, c... 62 2e-08
(Q8NYY2) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 62 2e-08
FP929052_253(FP929052|pid:none) Ruminococcus sp. 18P13 draft gen... 61 2e-08
(B5Y8D8) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 61 2e-08
(A7Z0D5) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 61 2e-08
CP001778_6070(CP001778|pid:none) Stackebrandtia nassauensis DSM ... 61 3e-08
CP002347_474(CP002347|pid:none) Calditerrivibrio nitroreducens D... 61 3e-08
(Q4J8I4) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 61 3e-08
CP002047_5288(CP002047|pid:none) Streptomyces bingchenggensis BC... 60 3e-08
(A3CTP4) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 60 4e-08
CP001712_337(CP001712|pid:none) Robiginitalea biformata HTCC2501... 60 4e-08
CP002444_1132(CP002444|pid:none) Thermovibrio ammonificans HB-1,... 60 4e-08
CP002330_1710(CP002330|pid:none) Caldicellulosiruptor kronotskye... 60 4e-08
CP002475_3049(CP002475|pid:none) Streptomyces flavogriseus ATCC ... 60 4e-08
(Q8SS48) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 60 4e-08
FP565809_49(FP565809|pid:none) Clostridium sticklandii str. DSM ... 60 4e-08
(P37464) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 60 6e-08
CP002468_2305(CP002468|pid:none) Bacillus subtilis BSn5, complet... 60 6e-08
AY116645_1(AY116645|pid:none) Streptomyces viridifaciens seryl-t... 59 8e-08
FP476056_2111(FP476056|pid:none) Zobellia galactanivorans strain... 59 8e-08
CP002583_1318(CP002583|pid:none) Marinomonas mediterranea MMB-1,... 59 8e-08
CP001982_12(CP001982|pid:none) Bacillus megaterium DSM319, compl... 59 1e-07
CP002993_3279(CP002993|pid:none) Streptomyces sp. SirexAA-E, com... 59 1e-07
(Q979Z3) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 59 1e-07
FP929053_2284(FP929053|pid:none) Ruminococcus sp. SR1/5 draft ge... 59 1e-07
CP001793_78(CP001793|pid:none) Paenibacillus sp. Y412MC10, compl... 59 1e-07
CP002644_1670(CP002644|pid:none) Streptococcus suis D12, complet... 59 1e-07
(A5D6D5) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 59 1e-07
HE576794_904(HE576794|pid:none) Megasphaera elsdenii strain DSM ... 59 1e-07
FP565575_2861(FP565575|pid:none) Candidatus Methylomirabilis oxy... 58 2e-07
FN554889_4481(FN554889|pid:none) Streptomyces scabiei 87.22 comp... 58 2e-07
(B8E0R9) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 58 2e-07
CP001104_1990(CP001104|pid:none) Eubacterium eligens ATCC 27750,... 58 2e-07
AM412317_510(AM412317|pid:none) Clostridium botulinum A str. ATC... 58 2e-07
CP000922_13(CP000922|pid:none) Anoxybacillus flavithermus WK1, c... 58 2e-07
CP001656_93(CP001656|pid:none) Paenibacillus sp. JDR-2, complete... 58 2e-07
(B9LQZ7) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 58 2e-07
CP002100_1942(CP002100|pid:none) Vulcanisaeta distributa DSM 144... 58 2e-07
CP002293_13(CP002293|pid:none) Geobacillus sp. Y4.1MC1, complete... 58 2e-07
AP012212_1675(AP012212|pid:none) Clostridium sp. SY8519 DNA, com... 58 2e-07
AP012157_93(AP012157|pid:none) Solibacillus silvestris StLB046 D... 58 2e-07
(B4U7F1) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 58 2e-07
CP003098_1316(CP003098|pid:none) Pyrobaculum sp. 1860, complete ... 58 2e-07
CP003107_1556(CP003107|pid:none) Paenibacillus terrae HPL-003, c... 57 3e-07
(Q970Y4) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 57 3e-07
CP001966_149(CP001966|pid:none) Tsukamurella paurometabola DSM 2... 57 3e-07
FN568063_1625(FN568063|pid:none) Streptococcus mitis B6 complete... 57 3e-07
CP002207_3692(CP002207|pid:none) Bacillus atrophaeus 1942, compl... 57 3e-07
FP929062_2442(FP929062|pid:none) Clostridiales sp. SS3/4 draft g... 57 3e-07
CP001739_1998(CP001739|pid:none) Sebaldella termitidis ATCC 3338... 57 3e-07
CP002281_616(CP002281|pid:none) Ilyobacter polytropus DSM 2926, ... 57 4e-07
(B2GF13) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 57 4e-07
CP002213_91(CP002213|pid:none) Paenibacillus polymyxa SC2, compl... 57 4e-07
CP002905_14(CP002905|pid:none) Bacillus subtilis subsp. spizizen... 57 4e-07
CP002033_41(CP002033|pid:none) Lactobacillus fermentum CECT 5716... 57 4e-07
CP002453_1835(CP002453|pid:none) Cellulophaga algicola DSM 14237... 57 4e-07
CP001581_531(CP001581|pid:none) Clostridium botulinum A2 str. Ky... 57 4e-07
CP002925_517(CP002925|pid:none) Streptococcus pseudopneumoniae I... 57 4e-07
(A8FAD7) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 57 4e-07
EU016568_1(EU016568|pid:none) Uncultured marine microorganism HF... 57 5e-07
CP000962_524(CP000962|pid:none) Clostridium botulinum A3 str. Lo... 57 5e-07
(B0RZY8) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 57 5e-07
CP002394_15(CP002394|pid:none) Bacillus cellulosilyticus DSM 252... 57 5e-07
(Q73FJ3) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 57 5e-07
(Q82FK8) RecName: Full=Seryl-tRNA synthetase 1; EC=6.1.... 57 5e-07
(A4IJ96) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 57 5e-07
CP000903_12(CP000903|pid:none) Bacillus weihenstephanensis KBAB4... 57 5e-07
(B7HII5) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 56 6e-07
CP000660_1601(CP000660|pid:none) Pyrobaculum arsenaticum DSM 135... 56 6e-07
CP001968_2334(CP001968|pid:none) Denitrovibrio acetiphilus DSM 1... 56 6e-07
(Q3ASQ9) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 56 6e-07
(A0R891) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 56 6e-07
(B7HPS8) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 56 6e-07
CP002529_391(CP002529|pid:none) Vulcanisaeta moutnovskia 768-28,... 56 8e-07
CP000154_86(CP000154|pid:none) Paenibacillus polymyxa E681, comp... 56 8e-07
CP002360_219(CP002360|pid:none) Mahella australiensis 50-1 BON, ... 55 1e-06
(Q5L3Y0) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 55 1e-06
CP000939_532(CP000939|pid:none) Clostridium botulinum B1 str. Ok... 55 1e-06
CP001886_765(CP001886|pid:none) Chlamydia trachomatis E/150, com... 55 1e-06
CP002050_13(CP002050|pid:none) Geobacillus sp. C56-T3, complete ... 55 1e-06
(A3CQ45) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 55 1e-06
CP001932_2145(CP001932|pid:none) Natrialba magadii ATCC 43099, c... 55 1e-06
CP002726_350(CP002726|pid:none) Hydrogenobaculum sp. 3684, compl... 55 1e-06
CP001742_267(CP001742|pid:none) Acidilobus saccharovorans 345-15... 55 1e-06
FQ312030_354(FQ312030|pid:none) Streptococcus pneumoniae INV104 ... 55 1e-06
(A0AM81) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 55 1e-06
CP002305_1955(CP002305|pid:none) Leadbetterella byssophila DSM 1... 55 1e-06
FP929048_339(FP929048|pid:none) Megamonas hypermegale ART12/1 dr... 55 1e-06
CP002105_28(CP002105|pid:none) Acetohalobium arabaticum DSM 5501... 55 2e-06
CP001997_972(CP001997|pid:none) Aminobacterium colombiense DSM 1... 55 2e-06
(Q0KDK9) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 55 2e-06
FM211688_2812(FM211688|pid:none) Listeria monocytogenes L99 sero... 55 2e-06
(B0B8V5) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 55 2e-06
CP002403_91(CP002403|pid:none) Ruminococcus albus 7, complete ge... 55 2e-06
CP002877_768(CP002877|pid:none) Cupriavidus necator N-1 chromoso... 55 2e-06
(B7IS31) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 55 2e-06
BC102680_1(BC102680|pid:none) Bos taurus seryl-tRNA synthetase, ... 55 2e-06
(B8DD73) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 55 2e-06
CP001348_3085(CP001348|pid:none) Clostridium cellulolyticum H10,... 54 2e-06
(C1CPS1) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 54 2e-06
CP001887_761(CP001887|pid:none) Chlamydia trachomatis G/9768, co... 54 2e-06
(C1C5E8) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 54 2e-06
CP000408_1790(CP000408|pid:none) Streptococcus suis 98HAH33, com... 54 2e-06
CP000407_1774(CP000407|pid:none) Streptococcus suis 05ZYH33, com... 54 2e-06
CP001033_410(CP001033|pid:none) Streptococcus pneumoniae CGSP14,... 54 2e-06
FM252032_1667(FM252032|pid:none) Streptococcus suis BM407 comple... 54 2e-06
(B3QV79) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 54 2e-06
AM946016_1535(AM946016|pid:none) Streptococcus suis P1/7 complet... 54 2e-06
(B8ZLH8) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 54 2e-06
CP002738_629(CP002738|pid:none) Methylomonas methanica MC09, com... 54 3e-06
(Q899T6) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 54 3e-06
EU016635_20(EU016635|pid:none) Uncultured Group I marine crenarc... 54 3e-06
(A1TTM6) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 54 3e-06
AP011112_1575(AP011112|pid:none) Hydrogenobacter thermophilus TK... 54 3e-06
(Q6MRK1) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 54 3e-06
AE015924_273(AE015924|pid:none) Porphyromonas gingivalis W83, co... 54 3e-06
CP003056_1197(CP003056|pid:none) Bacillus coagulans 36D1, comple... 54 3e-06
CP002727_2317(CP002727|pid:none) Pseudomonas fulva 12-X, complet... 54 3e-06
CP002472_73(CP002472|pid:none) Bacillus coagulans 2-6, complete ... 54 3e-06
(B2A2Z8) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 54 4e-06
(C3JY54) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 54 4e-06
EU016631_26(EU016631|pid:none) Uncultured Group I marine crenarc... 54 4e-06
CP001102_246(CP001102|pid:none) Candidatus Amoebophilus asiaticu... 54 4e-06
(Q2RMH8) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 54 4e-06
CP000245_3077(CP000245|pid:none) Ramlibacter tataouinensis TTB31... 54 4e-06
(Q255Z9) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 54 4e-06
(Q926Z9) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 53 5e-06
(B1I9K5) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 53 5e-06
CP002876_672(CP002876|pid:none) Nitrosomonas sp. Is79A3, complet... 53 5e-06
CP002480_1166(CP002480|pid:none) Granulicella sp. MP5ACTX9, comp... 53 5e-06
FP929036_623(FP929036|pid:none) Butyrivibrio fibrisolvens 16/4 d... 53 5e-06
CP001738_121(CP001738|pid:none) Thermomonospora curvata DSM 4318... 53 5e-06
X04616_21(X04616|pid:none) Synechococcus sp. PCC 7942 pmg1 (part... 53 7e-06
CP002177_2176(CP002177|pid:none) Acinetobacter calcoaceticus PHE... 53 7e-06
(A4SWP6) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 53 7e-06
CP002534_1756(CP002534|pid:none) Cellulophaga lytica DSM 7489, c... 53 7e-06
CP002471_216(CP002471|pid:none) Streptococcus parauberis KCTC 11... 53 7e-06
(Q8GMR7) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 53 7e-06
CP001229_1182(CP001229|pid:none) Sulfurihydrogenibium azorense A... 53 7e-06
CP000885_1102(CP000885|pid:none) Clostridium phytofermentans ISD... 52 9e-06
(B2VA33) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 52 9e-06
CP001956_1872(CP001956|pid:none) Haloferax volcanii DS2, complet... 52 9e-06
BA000016_14(BA000016|pid:none) Clostridium perfringens str. 13 D... 52 9e-06
(A1VH35) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 52 9e-06
CP001684_2553(CP001684|pid:none) Slackia heliotrinireducens DSM ... 52 9e-06
CP002620_2386(CP002620|pid:none) Pseudomonas mendocina NK-01, co... 52 9e-06
(Q0SWW9) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 52 9e-06
(Q8XPE9) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 52 9e-06
(Q0B0Y5) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 52 9e-06
CP003026_1390(CP003026|pid:none) Enterobacter asburiae LF7a, com... 52 9e-06
(Q72FH6) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 52 9e-06
CP002771_962(CP002771|pid:none) Marinomonas posidonica IVIA-Po-1... 52 1e-05
FM179323_1877(FM179323|pid:none) Lactobacillus rhamnosus Lc 705 ... 52 1e-05
(A5EXS3) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 52 1e-05
FP929040_1388(FP929040|pid:none) Enterobacter cloacae subsp. clo... 52 1e-05
AP009380_1646(AP009380|pid:none) Porphyromonas gingivalis ATCC 3... 52 1e-05
CP002349_2750(CP002349|pid:none) Marivirga tractuosa DSM 4126, c... 52 1e-05
CP002545_2385(CP002545|pid:none) Pedobacter saltans DSM 12145, c... 52 1e-05
FN869859_1585(FN869859|pid:none) Thermoproteus tenax Kra 1, comp... 52 1e-05
(A7I890) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 52 1e-05
CP003040_2316(CP003040|pid:none) Roseburia hominis A2-183, compl... 52 1e-05
CP001918_2730(CP001918|pid:none) Enterobacter cloacae subsp. clo... 52 1e-05
CP003094_1770(CP003094|pid:none) Lactobacillus rhamnosus ATCC 85... 52 1e-05
(Q02XG6) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 52 1e-05
CP001878_14(CP001878|pid:none) Bacillus pseudofirmus OF4, comple... 52 1e-05
(B3EF00) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 52 2e-05
CP002825_762(CP002825|pid:none) Lacinutrix sp. 5H-3-7-4, complet... 52 2e-05
CP001978_1816(CP001978|pid:none) Marinobacter adhaerens HP15, co... 52 2e-05
(B8DW52) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 52 2e-05
(A9NDR1) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 52 2e-05
(A9KFP4) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 52 2e-05
CP001964_3146(CP001964|pid:none) Cellulomonas flavigena DSM 2010... 52 2e-05
CP001931_1258(CP001931|pid:none) Thermocrinis albus DSM 14484, c... 52 2e-05
(Q0TV53) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 52 2e-05
JP288039_1(JP288039|pid:none) TSA: Pipa carvalhoi Pipa_carvalhoi... 52 2e-05
(A3MX52) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 52 2e-05
(A2RJ76) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 52 2e-05
(B5YGU2) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 52 2e-05
CP001860_366(CP001860|pid:none) Haloterrigena turkmenica DSM 551... 52 2e-05
AP012280_3580(AP012280|pid:none) Pseudomonas aeruginosa NCGM2.S1... 51 2e-05
(B3QM90) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 51 2e-05
CP001688_724(CP001688|pid:none) Halomicrobium mukohataei DSM 122... 51 2e-05
CP002013_740(CP002013|pid:none) Burkholderia sp. CCGE1002 chromo... 51 2e-05
(Q47GH9) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 51 2e-05
CP000090_2573(CP000090|pid:none) Ralstonia eutropha JMP134 chrom... 51 2e-05
CP002955_2380(CP002955|pid:none) Cyclobacterium marinum DSM 745,... 51 2e-05
CP002496_2355(CP002496|pid:none) Pseudomonas aeruginosa M18, com... 51 2e-05
(P67565) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 51 2e-05
CU459141_724(CU459141|pid:none) Acinetobacter baumannii str. AYE... 51 2e-05
(B7GXI2) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 51 2e-05
(B1Y9Y4) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 51 2e-05
CU468230_696(CU468230|pid:none) Acinetobacter baumannii str. SDF... 51 2e-05
(B2HXU5) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 51 2e-05
(Q6F2A0) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 51 3e-05
(Q4ZRL5) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 51 3e-05
(Q5L4Z0) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 51 3e-05
(Q48H74) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 51 3e-05
(B2T1A6) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 51 3e-05
CP001135_2184(CP001135|pid:none) Edwardsiella tarda EIB202, comp... 51 3e-05
(Q0W8S5) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 51 3e-05
GU474882_39(GU474882|pid:none) Uncultured Verrucomicrobiales bac... 51 3e-05
(Q87ZS9) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 51 3e-05
CP003058_220(CP003058|pid:none) Acidaminococcus intestini RyC-MR... 51 3e-05
CP003059_1135(CP003059|pid:none) Taylorella asinigenitalis MCE3,... 50 4e-05
CP002344_9(CP002344|pid:none) Thermaerobacter marianensis DSM 12... 50 4e-05
(B4SF71) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 50 4e-05
CP002725_1067(CP002725|pid:none) Gardnerella vaginalis HMP9231, ... 50 4e-05
CP001859_132(CP001859|pid:none) Acidaminococcus fermentans DSM 2... 50 4e-05
FP236530_420(FP236530|pid:none) Mycoplasma hominis strain PG21, ... 50 4e-05
CP002104_411(CP002104|pid:none) Gardnerella vaginalis ATCC 14019... 50 4e-05
AB114606_5(AB114606|pid:none) Streptococcus bovis manL, manM, ma... 50 4e-05
CP002881_2173(CP002881|pid:none) Pseudomonas stutzeri ATCC 17588... 50 4e-05
FQ859185_2988(FQ859185|pid:none) Streptomyces cattleya str. NRRL... 50 4e-05
CP002622_2284(CP002622|pid:none) Pseudomonas stutzeri DSM 4166, ... 50 4e-05
AP011548_1817(AP011548|pid:none) Lactobacillus rhamnosus ATCC 53... 50 4e-05
(C5BE90) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 50 5e-05
CP000750_247(CP000750|pid:none) Kineococcus radiotolerans SRS302... 50 5e-05
CP002691_3949(CP002691|pid:none) Haliscomenobacter hydrossis DSM... 50 5e-05
AE017199_302(AE017199|pid:none) Nanoarchaeum equitans Kin4-M, co... 50 5e-05
CP002666_3559(CP002666|pid:none) Cellulomonas fimi ATCC 484, com... 50 5e-05
HE575158_161(HE575158|pid:none) Weissella thailandensis fsh4-2 a... 50 5e-05
FO082060_1013(FO082060|pid:none) Methylomicrobium alcaliphilum s... 50 5e-05
CU207366_3453(CU207366|pid:none) Gramella forsetii KT0803 comple... 50 5e-05
CP002117_2647(CP002117|pid:none) Methanoplanus petrolearius DSM ... 50 5e-05
(P47251) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 50 5e-05
FP929049_2997(FP929049|pid:none) Roseburia intestinalis M50/1 dr... 50 5e-05
CP000316_942(CP000316|pid:none) Polaromonas sp. JS666, complete ... 50 5e-05
CP001666_13(CP001666|pid:none) Clostridium ljungdahlii DSM 13528... 50 6e-05
(Q8EU77) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 50 6e-05
CP001810_2928(CP001810|pid:none) Butyrivibrio proteoclasticus B3... 50 6e-05
(Q8EW01) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 50 6e-05
(Q31HK9) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 50 6e-05
CP001827_488(CP001827|pid:none) Dehalococcoides sp. VS, complete... 50 6e-05
(C5BIK4) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 50 6e-05
(Q6AH61) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 50 6e-05
(B1XVE1) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 50 6e-05
(Q67TJ8) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 50 6e-05
CP001820_508(CP001820|pid:none) Veillonella parvula DSM 2008, co... 49 8e-05
CP002215_1670(CP002215|pid:none) Streptococcus dysgalactiae subs... 49 8e-05
(C4K5T8) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 49 8e-05
(B3DX68) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 49 8e-05
(A9NE72) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 49 8e-05
AP012201_103(AP012201|pid:none) Melissococcus plutonius ATCC 353... 49 8e-05
(B9L131) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 49 8e-05
AP011529_1910(AP011529|pid:none) Deferribacter desulfuricans SSM... 49 8e-05
FN538970_14(FN538970|pid:none) Clostridium difficile CD196 compl... 49 8e-05
(Q3MCE0) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 49 1e-04
CP002417_4631(CP002417|pid:none) Variovorax paradoxus EPS, compl... 49 1e-04
(Q03PU5) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 49 1e-04
AK028154_1(AK028154|pid:none) Mus musculus adult male tongue cDN... 49 1e-04
(Q2IGB1) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 49 1e-04
(B4EV93) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 49 1e-04
(Q7VM65) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 49 1e-04
(B0BPF3) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 49 1e-04
CP002217_877(CP002217|pid:none) Burkholderia sp. CCGE1003 chromo... 49 1e-04
(Q9PLJ7) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 49 1e-04
(Q10YR2) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 49 1e-04
(Q7N6E7) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 49 1e-04
(Q18FL9) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 49 1e-04
CP000769_3936(CP000769|pid:none) Anaeromyxobacter sp. Fw109-5, c... 49 1e-04
CP001734_951(CP001734|pid:none) Desulfohalobium retbaense DSM 56... 49 1e-04
CP002824_2992(CP002824|pid:none) Enterobacter aerogenes KCTC 219... 49 1e-04
(A4IZ69) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 49 1e-04
CP002206_707(CP002206|pid:none) Pantoea vagans C9-1, complete ge... 49 1e-04
FP929037_2134(FP929037|pid:none) Clostridium saccharolyticum-lik... 49 1e-04
CP002290_1766(CP002290|pid:none) Pseudomonas putida BIRD-1, comp... 49 1e-04
(Q88FT2) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 49 1e-04
(C4KZX8) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 49 1e-04
CP002557_655(CP002557|pid:none) Francisella cf. novicida Fx1, co... 49 1e-04
CP002667_81(CP002667|pid:none) Gallibacterium anatis UMN179, com... 49 1e-04
FP929051_482(FP929051|pid:none) Ruminococcus bromii L2-63 draft ... 49 1e-04
CP002888_1679(CP002888|pid:none) Streptococcus salivarius 57.I, ... 49 1e-04
CP001891_3416(CP001891|pid:none) Klebsiella variicola At-22, com... 49 1e-04
(A0Q3T2) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 49 1e-04
FR873481_274(FR873481|pid:none) Streptococcus salivarius CCHSS3 ... 48 2e-04
EU042120_1(EU042120|pid:none) Epinephelus coioides Seryl-tRNA sy... 48 2e-04
CP002535_1130(CP002535|pid:none) Acidianus hospitalis W1, comple... 48 2e-04
CP002872_1674(CP002872|pid:none) Francisella sp. TX077308, compl... 48 2e-04
(B5E8F6) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 48 2e-04
(Q8YQ59) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 48 2e-04
FR824043_335(FR824043|pid:none) Streptococcus gallolyticus subsp... 48 2e-04
CP002449_3292(CP002449|pid:none) Alicycliphilus denitrificans BC... 48 2e-04
(O33780) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 48 2e-04
(Q47TZ5) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 48 2e-04
CP002340_312(CP002340|pid:none) Streptococcus thermophilus ND03,... 48 2e-04
CP001733_1709(CP001733|pid:none) Aggregatibacter actinomycetemco... 48 2e-04
FR871782_35(FR871782|pid:none) Lactobacillus pentosus MP-10 draf... 48 2e-04
CP002689_269(CP002689|pid:none) Porphyromonas asaccharolytica DS... 48 2e-04
CP001678_1390(CP001678|pid:none) Hirschia baltica ATCC 49814, co... 48 2e-04
FM162591_2836(FM162591|pid:none) Photorhabdus asymbiotica ATCC43... 48 2e-04
(Q0BHH5) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 48 2e-04
(A0LI63) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 48 2e-04
(B8HL86) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 48 2e-04
(Q5Z3K9) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 48 2e-04
AP012053_374(AP012053|pid:none) Streptococcus gallolyticus subsp... 48 2e-04
JF811944_1(JF811944|pid:none) Exiguobacterium sp. 11-28 seryl-tR... 48 2e-04
(A9BYK5) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 48 2e-04
(A6W0C9) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 47 3e-04
AP012046_192(AP012046|pid:none) Tetragenococcus halophilus NBRC ... 47 3e-04
CP001779_20(CP001779|pid:none) Streptobacillus moniliformis DSM ... 47 3e-04
CP001607_306(CP001607|pid:none) Aggregatibacter aphrophilus NJ87... 47 3e-04
(B2TUI5) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 47 3e-04
(A0Q5M5) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 47 3e-04
FP929038_2205(FP929038|pid:none) Coprococcus catus GD/7 draft ge... 47 3e-04
(Q8DSB7) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 47 3e-04
(B8DQP8) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 47 3e-04
(Q9HKX5) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 47 3e-04
(B7LN61) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 47 4e-04
(C6E7Z3) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 47 4e-04
JF811976_1(JF811976|pid:none) Exiguobacterium sp. N39 seryl-tRNA... 47 4e-04
GU474893_10(GU474893|pid:none) Uncultured gamma proteobacterium ... 47 4e-04
CP002160_13(CP002160|pid:none) Clostridium cellulovorans 743B, c... 47 4e-04
AP012202_8(AP012202|pid:none) Candidatus Arthromitus sp. SFB-mou... 47 4e-04
(B4U1C3) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 47 4e-04
(A1A9D6) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 47 4e-04
CP001849_334(CP001849|pid:none) Gardnerella vaginalis 409-05, co... 47 4e-04
(Q9Z736) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 47 4e-04
HQ622656_1(HQ622656|pid:none) Exiguobacterium sp. EPVM seryl-tRN... 47 4e-04
FQ311875_63(FQ311875|pid:none) Arthrobacter arilaitensis RE117 c... 47 4e-04
AE005174_1080(AE005174|pid:none) Escherichia coli O157:H7 EDL933... 47 4e-04
(A8AII9) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 47 4e-04
(Q0AJC4) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 47 4e-04
CP002123_538(CP002123|pid:none) Prevotella melaninogenica ATCC 2... 47 5e-04
CP002363_699(CP002363|pid:none) Desulfurococcus mucosus DSM 2162... 47 5e-04
(B0S8Z4) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 47 5e-04
(C3NEQ7) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 47 5e-04
CP002059_1929(CP002059|pid:none) 'Nostoc azollae' 0708, complete... 47 5e-04
(B3PNG9) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 47 5e-04
(Q88Z60) RecName: Full=Seryl-tRNA synthetase 1; EC=6.1.... 47 5e-04
(Q0I8C9) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 47 5e-04
(Q166J5) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 47 5e-04
CP002519_786(CP002519|pid:none) Burkholderia sp. CCGE1001 chromo... 47 5e-04
(C3MQH9) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 47 5e-04
CP002870_3368(CP002870|pid:none) Pseudomonas putida S16, complet... 47 5e-04
(B3W8V7) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 47 5e-04
(A4W8R7) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 46 7e-04
FN543502_958(FN543502|pid:none) Citrobacter rodentium ICC168, co... 46 7e-04
FP929056_1285(FP929056|pid:none) Synergistetes sp. SGP1 draft ge... 46 7e-04
(Q3SJH9) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 46 7e-04
(Q2YCN3) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 46 7e-04
(C5CWN5) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 46 9e-04
(B1KG49) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 46 9e-04
CP001875_1344(CP001875|pid:none) Pantoea ananatis LMG 20103, com... 46 9e-04
AP012032_667(AP012032|pid:none) Pantoea ananatis AJ13355 DNA, co... 46 9e-04
CP001814_134(CP001814|pid:none) Streptosporangium roseum DSM 430... 45 0.001
(A3DP85) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 45 0.001
CP002051_1041(CP002051|pid:none) Staphylothermus hellenicus DSM ... 45 0.001
(C6DF54) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 45 0.001
AP012044_4639(AP012044|pid:none) Oscillibacter valericigenes Sjm... 45 0.001
(A1WBD4) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 45 0.001
(Q6LT00) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 45 0.001
(Q65SK3) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 45 0.001
(A4TN29) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 45 0.001
CP002599_864(CP002599|pid:none) Burkholderia gladioli BSR3 chrom... 45 0.001
(A1JMG0) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 45 0.001
(Q12NE5) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 45 0.001
(B4TRS5) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 45 0.001
FR877557_817(FR877557|pid:none) Salmonella bongori NCTC 12419, c... 45 0.001
(B1JBE0) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.... 45 0.001
>(O81983) RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.11;
AltName: Full=Serine--tRNA ligase; Short=SerRS;
AltName: Full=Seryl-tRNA(Ser/Sec) synthetase;
&GN101135_1(GN101135|pid:none) &T31430(T31430)
&Z98761_1(Z98761|pid:none)
Length = 438
Score = 120 bits (302), Expect = 2e-26
Identities = 56/132 (42%), Positives = 87/132 (65%)
Frame = +2
Query: 32 LDIVLFRADKGGNPDLIRQSQKVRYANVDAVQEVIDLDKVVKETKYRLDNTNAEYAKLNK 211
LDI LFR +KGGNP+++R+SQ+ R A+V+ V E+I LDK ++ ++ L+ ++ ++NK
Sbjct: 2 LDINLFREEKGGNPEIVRESQRRRGASVEIVDEIIKLDKEWRQRQFELEQLRKDFNRINK 61
Query: 212 SVAMKKKAGESADEIIAQAEELNQSIIKLKAEVSEVELLLRKKLRPIGNIVHESVPIDNN 391
VA + +G A +I EE S K +AEV E L KL +GN+VH+SVP+ N+
Sbjct: 62 EVAKLRISGGDASSLIKNTEENKDSTAKKQAEVQEARTALYSKLETVGNLVHDSVPVSND 121
Query: 392 EDNNQIIKTWGE 427
E +N +++TWGE
Sbjct: 122 EADNAVVRTWGE 133
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 5349213
Number of Hits to DB: 877,268,588
Number of extensions: 13188873
Number of successful extensions: 47614
Number of sequences better than 10.0: 901
Number of HSP's gapped: 47457
Number of HSP's successfully gapped: 901
Length of query: 168
Length of database: 1,732,582,204
Length adjustment: 122
Effective length of query: 46
Effective length of database: 1,079,978,218
Effective search space: 49678998028
Effective search space used: 49678998028
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 30 (16.2 bits)
Dictyostelium discoideum cDNA Project Home