Homology VSB752 vs Protein

Query= VSB752 (VSB752Q) /CSM/VS/VSB7-C/VSB752Q.Seq.d/
         (394 letters)

Database: nrp_B
           5,349,213 sequences; 1,732,582,204 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AE010299_1578(AE010299|pid:none) Methanosarcina acetivorans str....    39   0.071
FN543107_180(FN543107|pid:none) Curvibacter putative symbiont of...    39   0.12
CP000930_2260(CP000930|pid:none) Heliobacterium modesticaldum Ic...    37   0.27
CP001229_1593(CP001229|pid:none) Sulfurihydrogenibium azorense A...    37   0.46
GU474869_40(GU474869|pid:none) Uncultured delta proteobacterium ...    36   0.60
GU474881_38(GU474881|pid:none) Uncultured Acidobacteriales bacte...    35   1.0
GU474883_37(GU474883|pid:none) Uncultured delta proteobacterium ...    34   2.3
GU474896_16(GU474896|pid:none) Uncultured Acidobacteria bacteriu...    34   3.0
CP002829_1424(CP002829|pid:none) Thermodesulfobacterium sp. OPB4...    34   3.0
CP001229_878(CP001229|pid:none) Sulfurihydrogenibium azorense Az...    33   3.9
BA000042_153(BA000042|pid:none) Nicotiana tabacum mitochondrial ...    33   3.9
GU474879_27(GU474879|pid:none) Uncultured delta proteobacterium ...    33   5.1
FQ790305_7(FQ790305|pid:none) Botryotinia fuckeliana isolate T4 ...    32   8.7
FN357533_3(FN357533|pid:none) Schistosoma mansoni genome sequenc...    32   8.7
EU170096_1(EU170096|pid:none) Tribolium castaneum gustatory rece...    32   8.7

>AE010299_1578(AE010299|pid:none) Methanosarcina acetivorans str.
           C2A, complete genome.
          Length = 125

 Score = 39.3 bits (90), Expect = 0.071
 Identities = 20/31 (64%), Positives = 21/31 (67%)
 Frame = -1

Query: 298 FTLLGFRSPLLTASLLIFFPTVTKMFHFTAF 206
           F L  F SPLLTAS LI FP  T+MF F AF
Sbjct: 61  FELCRFHSPLLTASQLISFPAPTEMFQFGAF 91

Lambda     K      H
   0.318    0.134    0.401

Gapped
Lambda     K      H
   0.267   0.0410    0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 5349213
Number of Hits to DB: 825,749,942
Number of extensions: 14545200
Number of successful extensions: 30965
Number of sequences better than 10.0: 15
Number of HSP's gapped: 30951
Number of HSP's successfully gapped: 15
Length of query: 131
Length of database: 1,732,582,204
Length adjustment: 96
Effective length of query: 35
Effective length of database: 1,219,057,756
Effective search space: 42667021460
Effective search space used: 42667021460
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 29 (15.8 bits)