Homology VHK609 vs Protein
Query= VHK609 (VHK609Q) /CSM/VH/VHK6-A/VHK609Q.Seq.d/
(1383 letters)
Database: nrp_B
5,349,213 sequences; 1,732,582,204 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
BT127859_1(BT127859|pid:none) Dendroctonus ponderosae clone DPO1... 233 2e-59
AK159737_1(AK159737|pid:none) Mus musculus osteoclast-like cell ... 232 3e-59
(Q5ZLC5) RecName: Full=ATP synthase subunit beta, mitochondrial;... 231 6e-59
(P38482) RecName: Full=ATP synthase subunit beta, mitochondrial;... 231 6e-59
BC067388_1(BC067388|pid:none) Xenopus tropicalis ATP synthase, H... 231 8e-59
BC037127_1(BC037127|pid:none) Mus musculus ATP synthase, H+ tran... 231 1e-58
(P72247) RecName: Full=ATP synthase subunit beta; EC=3.... 231 1e-58
AK166603_1(AK166603|pid:none) Mus musculus 4 days embryo whole b... 231 1e-58
(Q3U774) RecName: Full=ATP synthase subunit beta, mitochondrial;... 231 1e-58
(P10719) RecName: Full=ATP synthase subunit beta, mitochondrial;... 230 1e-58
A28701(A28701;S70510)H+-transporting two-sector ATPase (EC 3.6.3... 230 1e-58
DQ443322_1(DQ443322|pid:none) Bombyx mori H+ transporting ATP sy... 230 1e-58
DQ443321_1(DQ443321|pid:none) Bombyx mori H+ transporting ATP sy... 230 1e-58
AK167764_1(AK167764|pid:none) Mus musculus TIB-55 BB88 cDNA, RIK... 230 2e-58
GN102155_1(GN102155|pid:none) Sequence 6936 from Patent WO200903... 230 2e-58
HM156739_1(HM156739|pid:none) Helicoverpa zea ATP synthase mRNA,... 230 2e-58
(Q162S9) RecName: Full=ATP synthase subunit beta; EC=3.... 230 2e-58
(Q9PTY0) RecName: Full=ATP synthase subunit beta, mitochondrial;... 230 2e-58
D00022_1(D00022|pid:none) Homo sapiens mRNA for F1 beta subunit,... 229 2e-58
FJ208948_1(FJ208948|pid:none) Gillichthys mirabilis F1 ATP synth... 229 2e-58
BT120312_1(BT120312|pid:none) Drosophila melanogaster RE21838 fu... 229 2e-58
X05606_1(X05606|pid:none) Human mRNA fragment for ATP synthetase... 229 2e-58
(P06576) RecName: Full=ATP synthase subunit beta, mitochondrial;... 229 2e-58
(Q05825) RecName: Full=ATP synthase subunit beta, mitochondrial;... 229 2e-58
X05605_1(X05605|pid:none) Bovine mRNA fragment for ATP synthetas... 229 3e-58
(P00829) RecName: Full=ATP synthase subunit beta, mitochondrial;... 229 3e-58
BC124410_1(BC124410|pid:none) Danio rerio zgc:163069, mRNA (cDNA... 229 3e-58
AB104883_1(AB104883|pid:none) Zygosaccharomyces rouxii ZrATP2 ge... 229 3e-58
FN392320_1159(FN392320|pid:none) Pichia pastoris GS115 chromosom... 229 3e-58
(P49376) RecName: Full=ATP synthase subunit beta, mitochondrial;... 229 3e-58
BC046741_1(BC046741|pid:none) Xenopus laevis ATP synthase, H+ tr... 229 3e-58
AK151081_1(AK151081|pid:none) Mus musculus bone marrow macrophag... 229 4e-58
EZ424166_1(EZ424166|pid:none) TSA: Glossina morsitans morsitans ... 229 4e-58
(Q3YS09) RecName: Full=ATP synthase subunit beta; EC=3.... 229 4e-58
CP002347_1578(CP002347|pid:none) Calditerrivibrio nitroreducens ... 228 5e-58
CP002897_1144(CP002897|pid:none) Paracoccus denitrificans SD1, c... 228 5e-58
AB603754_1(AB603754|pid:none) Mesocricetus auratus atp5b mRNA fo... 228 5e-58
DQ440233_1(DQ440233|pid:none) Aedes aegypti clone AET-272 F0F1-t... 228 6e-58
CP002503_187(CP002503|pid:none) Eremothecium cymbalariae DBVPG#7... 228 6e-58
GN102063_1(GN102063|pid:none) Sequence 6844 from Patent WO200903... 228 6e-58
AY312637_1(AY312637|pid:none) Drosophila simulans strain DsimSey... 228 6e-58
GN102557_1(GN102557|pid:none) Sequence 7338 from Patent WO200903... 228 8e-58
FP929003_363(FP929003|pid:none) Candidatus Nitrospira defluvii c... 228 8e-58
CP000498_39(CP000498|pid:none) Scheffersomyces stipitis CBS 6054... 227 1e-57
AF030559_1(AF030559|pid:none) Mus musculus ATP synthase beta-sub... 227 1e-57
(Q11DD5) RecName: Full=ATP synthase subunit beta; EC=3.... 226 2e-57
CU928176_67(CU928176|pid:none) Zygosaccharomyces rouxii strain C... 226 2e-57
(Q01859) RecName: Full=ATP synthase subunit beta, mitochondrial;... 226 3e-57
EF148198_1(EF148198|pid:none) Populus trichocarpa clone WS0128_K... 226 3e-57
(A8LJR4) RecName: Full=ATP synthase subunit beta 2; EC=... 225 4e-57
AJ843974_1(AJ843974|pid:none) Plantago major partial mRNA for mi... 225 5e-57
AP008207_2168(AP008207|pid:none) Oryza sativa (japonica cultivar... 225 5e-57
CP002018_455(CP002018|pid:none) Ketogulonigenium vulgarum WSH-00... 225 5e-57
GN102563_1(GN102563|pid:none) Sequence 7344 from Patent WO200903... 225 5e-57
GN102555_1(GN102555|pid:none) Sequence 7336 from Patent WO200903... 225 5e-57
CP000613_2186(CP000613|pid:none) Rhodospirillum centenum SW, com... 225 5e-57
GN102561_1(GN102561|pid:none) Sequence 7342 from Patent WO200903... 225 5e-57
AJ870436_1(AJ870436|pid:none) Polytomella sp. Pringsheim 198.80 ... 225 5e-57
AP010803_2685(AP010803|pid:none) Sphingobium japonicum UT26S DNA... 224 7e-57
EF085070_1(EF085070|pid:none) Picea sitchensis clone WS02728_O12... 224 7e-57
(P43395) RecName: Full=ATP synthase subunit beta, mitochondrial;... 224 7e-57
(B6JD09) RecName: Full=ATP synthase subunit beta; EC=3.... 224 7e-57
EU401720_1(EU401720|pid:none) Litopenaeus vannamei F1-ATP syntha... 224 7e-57
GN102565_1(GN102565|pid:none) Sequence 7346 from Patent WO200903... 224 9e-57
GN102059_1(GN102059|pid:none) Sequence 6840 from Patent WO200903... 224 9e-57
M19483_1(M19483|pid:none) Human ATP synthase beta subunit gene, ... 224 9e-57
DQ358698_1(DQ358698|pid:none) Pinctada fucata ATP synthase beta ... 224 9e-57
(A9H9A8) RecName: Full=ATP synthase subunit beta; EC=3.... 224 9e-57
CR382128_148(CR382128|pid:none) Yarrowia lipolytica strain CLIB1... 224 9e-57
(Q1RKD7) RecName: Full=ATP synthase subunit beta; EC=3.... 224 1e-56
(C0R5I6) RecName: Full=ATP synthase subunit beta; EC=3.... 224 1e-56
AP012206_402(AP012206|pid:none) Bradyrhizobium japonicum USDA 6 ... 224 1e-56
FN319667_1(FN319667|pid:none) Schistosoma japonicum isolate Anhu... 223 2e-56
(P46561) RecName: Full=ATP synthase subunit beta, mitochondrial;... 223 2e-56
FJ605485_1(FJ605485|pid:none) Procambarus clarkii F1F0-ATP synth... 223 2e-56
AK364060_1(AK364060|pid:none) Hordeum vulgare subsp. vulgare mRN... 223 2e-56
FN319664_1(FN319664|pid:none) Schistosoma japonicum isolate Anhu... 223 2e-56
CP002029_93(CP002029|pid:none) Campylobacter jejuni subsp. jejun... 223 2e-56
(A1VXJ0) RecName: Full=ATP synthase subunit beta; EC=3.... 223 2e-56
FJ042670_1(FJ042670|pid:none) Fenneropenaeus chinensis F1F0-ATP ... 223 2e-56
D10491_1(D10491|pid:none) Oryza sativa Japonica Group atpB gene ... 223 2e-56
(A7ZC37) RecName: Full=ATP synthase subunit beta; EC=3.... 223 2e-56
(B0THN2) RecName: Full=ATP synthase subunit beta; EC=3.... 223 3e-56
AE017346_61(AE017346|pid:none) Cryptococcus neoformans var. neof... 223 3e-56
CP002083_3369(CP002083|pid:none) Hyphomicrobium denitrificans AT... 222 3e-56
CP001016_215(CP001016|pid:none) Beijerinckia indica subsp. indic... 222 3e-56
(A4WUM7) RecName: Full=ATP synthase subunit beta; EC=3.... 222 3e-56
(A4YKE0) RecName: Full=ATP synthase subunit beta; EC=3.... 222 5e-56
GN102123_1(GN102123|pid:none) Sequence 6904 from Patent WO200903... 222 5e-56
(Q2VZN2) RecName: Full=ATP synthase subunit beta; EC=3.... 222 5e-56
CP000683_877(CP000683|pid:none) Rickettsia massiliae MTU5, compl... 222 5e-56
(Q73IG3) RecName: Full=ATP synthase subunit beta; EC=3.... 222 5e-56
(Q2G5N5) RecName: Full=ATP synthase subunit beta; EC=3.... 222 5e-56
(A5E950) RecName: Full=ATP synthase subunit beta 1; EC=... 222 5e-56
GN102197_1(GN102197|pid:none) Sequence 6978 from Patent WO200903... 221 6e-56
(Q68VU8) RecName: Full=ATP synthase subunit beta; EC=3.... 221 6e-56
(A8GY40) RecName: Full=ATP synthase subunit beta; EC=3.... 221 6e-56
(P17614) RecName: Full=ATP synthase subunit beta, mitochondrial;... 221 6e-56
CP003075_3118(CP003075|pid:none) Pelagibacterium halotolerans B2... 221 6e-56
GN102239_1(GN102239|pid:none) Sequence 7020 from Patent WO200903... 221 6e-56
(B3CN17) RecName: Full=ATP synthase subunit beta; EC=3.... 221 6e-56
(P83483) RecName: Full=ATP synthase subunit beta-1, mitochondria... 221 8e-56
AP012159_1411(AP012159|pid:none) Gluconacetobacter xylinus NBRC ... 221 8e-56
BT000796_1(BT000796|pid:none) Arabidopsis thaliana unknown prote... 221 8e-56
CP002688_1055(CP002688|pid:none) Arabidopsis thaliana chromosome... 221 8e-56
AK359072_1(AK359072|pid:none) Hordeum vulgare subsp. vulgare mRN... 221 8e-56
(A8GPZ4) RecName: Full=ATP synthase subunit beta; EC=3.... 221 8e-56
(Q89X74) RecName: Full=ATP synthase subunit beta; EC=3.... 221 8e-56
AJ271468_1(AJ271468|pid:none) Arabidopsis thaliana mRNA for mito... 221 8e-56
CP002279_1197(CP002279|pid:none) Mesorhizobium opportunistum WSM... 221 8e-56
AK229974_1(AK229974|pid:none) Arabidopsis thaliana mRNA for H+-t... 221 8e-56
(P83484) RecName: Full=ATP synthase subunit beta-2, mitochondria... 221 8e-56
AP011529_1840(AP011529|pid:none) Deferribacter desulfuricans SSM... 221 8e-56
AP011121_117(AP011121|pid:none) Acetobacter pasteurianus IFO 328... 221 1e-55
(A8F004) RecName: Full=ATP synthase subunit beta; EC=3.... 221 1e-55
(A5VSE1) RecName: Full=ATP synthase subunit beta; EC=3.... 221 1e-55
GQ922833_1(GQ922833|pid:none) Pseudozyma flocculosa ATP synthase... 221 1e-55
GN102065_1(GN102065|pid:none) Sequence 6846 from Patent WO200903... 221 1e-55
(A3PIB9) RecName: Full=ATP synthase subunit beta 1; EC=... 221 1e-55
CP002447_1168(CP002447|pid:none) Mesorhizobium ciceri biovar bis... 220 1e-55
CP001280_337(CP001280|pid:none) Methylocella silvestris BL2, com... 220 1e-55
GN102205_1(GN102205|pid:none) Sequence 6986 from Patent WO200903... 220 1e-55
CP001349_7065(CP001349|pid:none) Methylobacterium nodulans ORS 2... 220 1e-55
(Q2YLE6) RecName: Full=ATP synthase subunit beta; EC=3.... 220 1e-55
CP002355_757(CP002355|pid:none) Sulfuricurvum kujiense DSM 16994... 220 2e-55
(P42469) RecName: Full=ATP synthase subunit beta; EC=3.... 220 2e-55
CP001751_1844(CP001751|pid:none) Candidatus Puniceispirillum mar... 219 2e-55
CP002271_938(CP002271|pid:none) Stigmatella aurantiaca DW4/3-1, ... 219 2e-55
(A7HIX7) RecName: Full=ATP synthase subunit beta; EC=3.... 219 3e-55
(Q13DP2) RecName: Full=ATP synthase subunit beta; EC=3.... 219 3e-55
DQ674545_1(DQ674545|pid:none) Coccidioides posadasii ATP synthas... 219 3e-55
(Q0BQE8) RecName: Full=ATP synthase subunit beta; EC=3.... 219 4e-55
CP002131_1943(CP002131|pid:none) Thermosediminibacter oceani DSM... 219 4e-55
(Q25117) RecName: Full=ATP synthase subunit beta, mitochondrial;... 219 4e-55
AP007175_411(AP007175|pid:none) Aspergillus oryzae RIB40 DNA, SC... 219 4e-55
AC144731_35(AC144731|pid:none) Medicago truncatula clone mth2-5g... 219 4e-55
(O50290) RecName: Full=ATP synthase subunit beta; EC=3.... 218 5e-55
CP001584_852(CP001584|pid:none) Rickettsia prowazekii Rp22, comp... 218 5e-55
(Q3SVJ1) RecName: Full=ATP synthase subunit beta; EC=3.... 218 5e-55
(B0SDA5) RecName: Full=ATP synthase subunit beta; EC=3.... 218 5e-55
(Q1MAZ2) RecName: Full=ATP synthase subunit beta; EC=3.... 218 7e-55
AB266032_1(AB266032|pid:none) Dicyema acuticephalum gene for ATP... 218 7e-55
(A6WXX1) RecName: Full=ATP synthase subunit beta; EC=3.... 218 9e-55
AP012035_1725(AP012035|pid:none) Acidiphilium multivorum AIU301 ... 218 9e-55
AE017321_685(AE017321|pid:none) Wolbachia endosymbiont strain TR... 218 9e-55
AK374834_1(AK374834|pid:none) Hordeum vulgare subsp. vulgare mRN... 217 1e-54
(B0T335) RecName: Full=ATP synthase subunit beta; EC=3.... 217 1e-54
CP002085_285(CP002085|pid:none) Desulfarculus baarsii DSM 2075, ... 217 1e-54
CP003008_543(CP003008|pid:none) Myceliophthora thermophila ATCC ... 217 1e-54
(A1ALL7) RecName: Full=ATP synthase subunit beta 1; EC=... 217 1e-54
CP002330_1226(CP002330|pid:none) Caldicellulosiruptor kronotskye... 217 1e-54
CP003001_747(CP003001|pid:none) Caldicellulosiruptor lactoacetic... 217 1e-54
(B3EA01) RecName: Full=ATP synthase subunit beta; EC=3.... 217 1e-54
(Q5PAN2) RecName: Full=ATP synthase subunit beta; EC=3.... 217 1e-54
CP001079_454(CP001079|pid:none) Anaplasma marginale str. Florida... 217 1e-54
GU292799_1(GU292799|pid:none) Miniopterus fuliginosus mitochondr... 217 1e-54
CP002304_379(CP002304|pid:none) Halanaerobium hydrogeniformans, ... 216 2e-54
(C3M9S1) RecName: Full=ATP synthase subunit beta; EC=3.... 216 2e-54
(Q0AKW0) RecName: Full=ATP synthase subunit beta; EC=3.... 216 2e-54
CP001131_4443(CP001131|pid:none) Anaeromyxobacter sp. K, complet... 216 2e-54
CU638744_194(CU638744|pid:none) Podospora anserina S mat+ genomi... 216 2e-54
(C4K227) RecName: Full=ATP synthase subunit beta; EC=3.... 216 2e-54
CP001896_46(CP001896|pid:none) Allochromatium vinosum DSM 180, c... 216 2e-54
CP001968_856(CP001968|pid:none) Denitrovibrio acetiphilus DSM 12... 216 3e-54
FM162591_36(FM162591|pid:none) Photorhabdus asymbiotica ATCC4394... 216 3e-54
CP000633_3010(CP000633|pid:none) Agrobacterium vitis S4 chromoso... 216 3e-54
GN102129_1(GN102129|pid:none) Sequence 6910 from Patent WO200903... 216 3e-54
CP002829_1507(CP002829|pid:none) Thermodesulfobacterium sp. OPB4... 216 3e-54
AE006914_1235(AE006914|pid:none) Rickettsia conorii str. Malish ... 216 3e-54
CP002480_1127(CP002480|pid:none) Granulicella sp. MP5ACTX9, comp... 216 3e-54
CP002912_1166(CP002912|pid:none) Rickettsia heilongjiangensis 05... 216 3e-54
(C3PLT1) RecName: Full=ATP synthase subunit beta; EC=3.... 216 3e-54
(A8GTS6) RecName: Full=ATP synthase subunit beta; EC=3.... 216 3e-54
CP000766_1244(CP000766|pid:none) Rickettsia rickettsii str. Iowa... 216 3e-54
(P05038) RecName: Full=ATP synthase subunit beta; EC=3.... 216 3e-54
DQ403107_1(DQ403107|pid:none) Homo sapiens mitochondrial ATP syn... 216 3e-54
CP001622_3870(CP001622|pid:none) Rhizobium leguminosarum bv. tri... 216 3e-54
M12082_1(M12082|pid:none) Yeast (S.cerevisiae) nuclear ATP2 gene... 216 3e-54
CP000628_3248(CP000628|pid:none) Agrobacterium radiobacter K84 c... 215 4e-54
(Q1QQS8) RecName: Full=ATP synthase subunit beta; EC=3.... 215 4e-54
GN102053_1(GN102053|pid:none) Sequence 6834 from Patent WO200903... 215 4e-54
(A1RQB0) RecName: Full=ATP synthase subunit beta; EC=3.... 215 6e-54
(Q7NA94) RecName: Full=ATP synthase subunit beta; EC=3.... 215 6e-54
Y15178_1(Y15178|pid:none) Sorghum bicolor F1-ATP synthase, culti... 215 6e-54
CP002511_489(CP002511|pid:none) Candidatus Pelagibacter sp. IMCC... 215 6e-54
FP929064_427(FP929064|pid:none) Leptosphaeria maculans JN3 lm_Su... 215 6e-54
(Q1IIG8) RecName: Full=ATP synthase subunit beta; EC=3.... 214 7e-54
CP002431_3072(CP002431|pid:none) Desulfovibrio aespoeensis Aspo-... 214 7e-54
AM910996_536(AM910996|pid:none) Plasmodium knowlesi strain H chr... 214 7e-54
CP001104_1871(CP001104|pid:none) Eubacterium eligens ATCC 27750,... 214 7e-54
(B3EJK9) RecName: Full=ATP synthase subunit beta; EC=3.... 214 7e-54
AF025802_1(AF025802|pid:none) Drosophila subobscura ATP synthase... 214 1e-53
FP565176_2845(FP565176|pid:none) Xanthomonas albilineans str. GP... 214 1e-53
(Q6CYJ5) RecName: Full=ATP synthase subunit beta; EC=3.... 214 1e-53
(A4Y187) RecName: Full=ATP synthase subunit beta; EC=3.... 214 1e-53
AY897519_1(AY897519|pid:none) Wolbachia endosymbiont of Drosophi... 214 1e-53
AM270321_1(AM270321|pid:none) Aspergillus niger contig An14c0140... 214 1e-53
CP001574_443(CP001574|pid:none) Micromonas sp. RCC299 chromosome... 214 1e-53
CP002727_4443(CP002727|pid:none) Pseudomonas fulva 12-X, complet... 214 1e-53
CP000908_1438(CP000908|pid:none) Methylobacterium extorquens PA1... 214 1e-53
(Q5FRC5) RecName: Full=ATP synthase subunit beta 1; EC=... 214 1e-53
AP010946_2492(AP010946|pid:none) Azospirillum sp. B510 DNA, comp... 214 1e-53
(C3K1E6) RecName: Full=ATP synthase subunit beta; EC=3.... 214 1e-53
CP001707_2613(CP001707|pid:none) Kangiella koreensis DSM 16069, ... 214 1e-53
(C6DJH2) RecName: Full=ATP synthase subunit beta; EC=3.... 214 1e-53
GN102167_1(GN102167|pid:none) Sequence 6948 from Patent WO200903... 214 1e-53
CP001108_50(CP001108|pid:none) Prosthecochloris aestuarii DSM 27... 213 2e-53
(Q313W0) RecName: Full=ATP synthase subunit beta; EC=3.... 213 2e-53
CP002585_6078(CP002585|pid:none) Pseudomonas brassicacearum subs... 213 2e-53
(Q65Q07) RecName: Full=ATP synthase subunit beta; EC=3.... 213 2e-53
FR823389_184(FR823389|pid:none) Neospora caninum Liverpool compl... 213 2e-53
(Q87TT4) RecName: Full=ATP synthase subunit beta; EC=3.... 213 2e-53
CP002780_3581(CP002780|pid:none) Desulfotomaculum ruminis DSM 21... 213 2e-53
DQ228960_1(DQ228960|pid:none) Toxoplasma gondii mitochondrial F1... 213 2e-53
(A3DAR4) RecName: Full=ATP synthase subunit beta; EC=3.... 213 2e-53
(B3PQ68) RecName: Full=ATP synthase subunit beta; EC=3.... 213 2e-53
(Q48BG5) RecName: Full=ATP synthase subunit beta; EC=3.... 213 2e-53
(A7I177) RecName: Full=ATP synthase subunit beta; EC=3.... 213 2e-53
(A1VFJ5) RecName: Full=ATP synthase subunit beta; EC=3.... 213 2e-53
FR824232_13(FR824232|pid:none) Albugo laibachii Nc14, genomic co... 213 2e-53
CP000096_21(CP000096|pid:none) Chlorobium luteolum DSM 273, comp... 213 2e-53
CP002246_3926(CP002246|pid:none) Yersinia enterocolitica subsp. ... 213 2e-53
FP565575_2881(FP565575|pid:none) Candidatus Methylomirabilis oxy... 213 2e-53
(A0LLF8) RecName: Full=ATP synthase subunit beta; EC=3.... 213 2e-53
(A4TSJ3) RecName: Full=ATP synthase subunit beta; EC=3.... 213 2e-53
AM920436_1007(AM920436|pid:none) Penicillium chrysogenum Wiscons... 213 2e-53
CP001593_3534(CP001593|pid:none) Yersinia pestis Z176003, comple... 213 2e-53
(A8G1W5) RecName: Full=ATP synthase subunit beta; EC=3.... 213 3e-53
(A8HAG3) RecName: Full=ATP synthase subunit beta; EC=3.... 213 3e-53
FJ599948_1(FJ599948|pid:none) Pfiesteria piscicida clone Ppi+Rho... 213 3e-53
GN102127_1(GN102127|pid:none) Sequence 6908 from Patent WO200903... 213 3e-53
CP002505_4369(CP002505|pid:none) Rahnella sp. Y9602, complete ge... 213 3e-53
(Q8KAC9) RecName: Full=ATP synthase subunit beta 2; EC=... 213 3e-53
(Q07VU4) RecName: Full=ATP synthase subunit beta 1; EC=... 213 3e-53
(B0UWG5) RecName: Full=ATP synthase subunit beta; EC=3.... 213 3e-53
AF283808_8(AF283808|pid:none) Clostridium pasteurianum atp opero... 212 4e-53
(A1AHR4) RecName: Full=ATP synthase subunit beta; EC=3.... 212 4e-53
(Q1MRB8) RecName: Full=ATP synthase subunit beta; EC=3.... 212 4e-53
CP002890_4483(CP002890|pid:none) Escherichia coli UMNF18, comple... 212 4e-53
(Q329S1) RecName: Full=ATP synthase subunit beta; EC=3.... 212 4e-53
(A8A6J5) RecName: Full=ATP synthase subunit beta; EC=3.... 212 4e-53
(Q3K441) RecName: Full=ATP synthase subunit beta; EC=3.... 212 4e-53
(Q2K3H0) RecName: Full=ATP synthase subunit beta; EC=3.... 212 4e-53
(B1I6J7) RecName: Full=ATP synthase subunit beta; EC=3.... 212 4e-53
(B4F0E7) RecName: Full=ATP synthase subunit beta; EC=3.... 212 4e-53
(A5WBW1) RecName: Full=ATP synthase subunit beta; EC=3.... 212 5e-53
(Q24MP1) RecName: Full=ATP synthase subunit beta; EC=3.... 212 5e-53
AF188265_8(AF188265|pid:none) Salmonella typhimurium strain TA98... 212 5e-53
(A1SBU0) RecName: Full=ATP synthase subunit beta; EC=3.... 212 5e-53
(Q2RFX9) RecName: Full=ATP synthase subunit beta; EC=3.... 212 5e-53
FQ790286_270(FQ790286|pid:none) Botryotinia fuckeliana isolate T... 212 5e-53
FN645454_1262(FN645454|pid:none) Bartonella clarridgeiae strain ... 211 6e-53
(A5CDA5) RecName: Full=ATP synthase subunit beta; EC=3.... 211 6e-53
CP002005_382(CP002005|pid:none) Moraxella catarrhalis RH4, compl... 211 6e-53
AB003549_1(AB003549|pid:none) Pisum sativum mRNA for F1 ATPase, ... 211 6e-53
CP002824_1418(CP002824|pid:none) Enterobacter aerogenes KCTC 219... 211 6e-53
(C6E9F1) RecName: Full=ATP synthase subunit beta; EC=3.... 211 6e-53
(B5EFI7) RecName: Full=ATP synthase subunit beta; EC=3.... 211 6e-53
CP001918_5103(CP001918|pid:none) Enterobacter cloacae subsp. clo... 211 6e-53
(A6VL57) RecName: Full=ATP synthase subunit beta; EC=3.... 211 8e-53
FN645467_51(FN645467|pid:none) Bartonella rochalimae ATCC BAA-14... 211 8e-53
(A1BCJ2) RecName: Full=ATP synthase subunit beta; EC=3.... 211 8e-53
(B5RFW3) RecName: Full=ATP synthase subunit beta; EC=3.... 211 8e-53
(A8ACN6) RecName: Full=ATP synthase subunit beta; EC=3.... 211 8e-53
CP001785_82(CP001785|pid:none) Ammonifex degensii KC4, complete ... 211 8e-53
(B8FZ34) RecName: Full=ATP synthase subunit beta; EC=3.... 211 8e-53
(P42465) RecName: Full=ATP synthase subunit beta; EC=3.... 211 8e-53
GQ330912_1(GQ330912|pid:none) Darwinella muelleri ATP synthase b... 211 8e-53
(A9IYW6) RecName: Full=ATP synthase subunit beta; EC=3.... 211 8e-53
FJ555372_1(FJ555372|pid:none) Brachionus plicatilis ATP synthase... 211 8e-53
FN543093_10(FN543093|pid:none) Cronobacter turicensis z3032 comp... 211 8e-53
(B3CRK6) RecName: Full=ATP synthase subunit beta; EC=3.... 211 8e-53
(A9MJR9) RecName: Full=ATP synthase subunit beta; EC=3.... 211 8e-53
(A7MMW9) RecName: Full=ATP synthase subunit beta; EC=3.... 211 8e-53
(B1JFU1) RecName: Full=ATP synthase subunit beta; EC=3.... 211 1e-52
CP001798_3734(CP001798|pid:none) Nitrosococcus halophilus Nc4, c... 211 1e-52
(B0KRA8) RecName: Full=ATP synthase subunit beta; EC=3.... 211 1e-52
(Q04S18) RecName: Full=ATP synthase subunit beta; EC=3.... 211 1e-52
CP002364_2594(CP002364|pid:none) Desulfobulbus propionicus DSM 2... 211 1e-52
(Q1CX36) RecName: Full=ATP synthase subunit beta; EC=3.... 211 1e-52
(Q0QEP2) RecName: Full=ATP synthase subunit beta, mitochondrial;... 211 1e-52
FN543502_3933(FN543502|pid:none) Citrobacter rodentium ICC168, c... 211 1e-52
(B2FHY8) RecName: Full=ATP synthase subunit beta; EC=3.... 210 1e-52
GN102397_1(GN102397|pid:none) Sequence 7178 from Patent WO200903... 210 1e-52
(A5EXL4) RecName: Full=ATP synthase subunit beta; EC=3.... 210 1e-52
(Q72SX9) RecName: Full=ATP synthase subunit beta; EC=3.... 210 1e-52
CP003026_4387(CP003026|pid:none) Enterobacter asburiae LF7a, com... 210 1e-52
GQ330991_1(GQ330991|pid:none) Haliclona sp. KJP-2009 ATP synthas... 210 1e-52
CP001277_2092(CP001277|pid:none) Candidatus Hamiltonella defensa... 210 1e-52
CP002986_3529(CP002986|pid:none) Stenotrophomonas maltophilia JV... 210 1e-52
(A4WGF5) RecName: Full=ATP synthase subunit beta; EC=3.... 210 1e-52
(Q4FQ37) RecName: Full=ATP synthase subunit beta; EC=3.... 210 1e-52
GN102159_1(GN102159|pid:none) Sequence 6940 from Patent WO200903... 210 2e-52
FN645485_151(FN645485|pid:none) Bartonella sp. AR 15-3 contig18,... 210 2e-52
CP001654_3927(CP001654|pid:none) Dickeya dadantii Ech703, comple... 210 2e-52
(Q67TB7) RecName: Full=ATP synthase subunit beta; EC=3.... 209 2e-52
(A7IH31) RecName: Full=ATP synthase subunit beta; EC=3.... 209 2e-52
CP002526_4213(CP002526|pid:none) Glaciecola sp. 4H-3-7+YE-5, com... 209 2e-52
DQ403114_1(DQ403114|pid:none) Diceros bicornis mitochondrial ATP... 209 3e-52
(A1UR49) RecName: Full=ATP synthase subunit beta; EC=3.... 209 3e-52
(A3M144) RecName: Full=ATP synthase subunit beta; EC=3.... 209 3e-52
(Q1I2I7) RecName: Full=ATP synthase subunit beta; EC=3.... 209 3e-52
(A0L2S8) RecName: Full=ATP synthase subunit beta; EC=3.... 209 3e-52
CP001607_1869(CP001607|pid:none) Aggregatibacter aphrophilus NJ8... 209 3e-52
(B4SAN6) RecName: Full=ATP synthase subunit beta; EC=3.... 209 3e-52
CP002739_1778(CP002739|pid:none) Thermoanaerobacterium xylanolyt... 209 3e-52
(B0BRX2) RecName: Full=ATP synthase subunit beta; EC=3.... 209 3e-52
AP012224_3686(AP012224|pid:none) Pseudogulbenkiania sp. NH8B DNA... 209 4e-52
FN545181_31(FN545181|pid:none) Arsenophonus nasoniae whole genom... 209 4e-52
DQ403105_1(DQ403105|pid:none) Oryctolagus cuniculus mitochondria... 209 4e-52
CP002433_3940(CP002433|pid:none) Pantoea sp. At-9b, complete gen... 209 4e-52
CP001820_1519(CP001820|pid:none) Veillonella parvula DSM 2008, c... 209 4e-52
(Q5HB71) RecName: Full=ATP synthase subunit beta; EC=3.... 209 4e-52
(A6VF32) RecName: Full=ATP synthase subunit beta; EC=3.... 209 4e-52
DQ403116_1(DQ403116|pid:none) Balaenoptera physalus mitochondria... 209 4e-52
(A5G9D8) RecName: Full=ATP synthase subunit beta; EC=3.... 208 5e-52
(Q9JXQ2) RecName: Full=ATP synthase subunit beta; EC=3.... 208 5e-52
AM889136_230(AM889136|pid:none) Neisseria meningitidis alpha14 c... 208 5e-52
CP002870_5211(CP002870|pid:none) Pseudomonas putida S16, complet... 208 5e-52
(A5WBA3) RecName: Full=ATP synthase subunit beta; EC=3.... 208 5e-52
FN995097_1835(FN995097|pid:none) Neisseria lactamica 020-06 comp... 208 5e-52
D64071(D64071)H+-transporting two-sector ATPase (EC 3.6.3.14) be... 208 7e-52
(Q8RC15) RecName: Full=ATP synthase subunit beta; EC=3.... 208 7e-52
CP002206_3178(CP002206|pid:none) Pantoea vagans C9-1, complete g... 208 7e-52
CP002032_655(CP002032|pid:none) Thermoanaerobacter mathranii sub... 208 7e-52
(B1KQ34) RecName: Full=ATP synthase subunit beta; EC=3.... 208 7e-52
CP002607_4005(CP002607|pid:none) Aeromonas veronii B565, complet... 208 7e-52
(A3DIM9) RecName: Full=ATP synthase subunit beta; EC=3.... 208 7e-52
(A3N2U4) RecName: Full=ATP synthase subunit beta; EC=3.... 208 7e-52
CP002048_2215(CP002048|pid:none) Syntrophothermus lipocalidus DS... 208 7e-52
(P43715) RecName: Full=ATP synthase subunit beta; EC=3.... 208 7e-52
(B3PIS7) RecName: Full=ATP synthase subunit beta; EC=3.... 208 7e-52
(A9KBF7) RecName: Full=ATP synthase subunit beta; EC=3.... 207 9e-52
CP000554_498(CP000554|pid:none) Prochlorococcus marinus str. MIT... 207 9e-52
(Q2S6P1) RecName: Full=ATP synthase subunit beta; EC=3.... 207 9e-52
FP929038_633(FP929038|pid:none) Coprococcus catus GD/7 draft gen... 207 9e-52
AP012048_2072(AP012048|pid:none) Arcobacter sp. L DNA, complete ... 207 9e-52
(Q03235) RecName: Full=ATP synthase subunit beta; EC=3.... 207 9e-52
(A6LJR1) RecName: Full=ATP synthase subunit beta; EC=3.... 207 9e-52
CP002371_65(CP002371|pid:none) Candidatus Liberibacter solanacea... 207 9e-52
FN392235_3975(FN392235|pid:none) Erwinia pyrifoliae DSM 12163 co... 207 9e-52
(Q3SF66) RecName: Full=ATP synthase subunit beta; EC=3.... 207 9e-52
AE016828_1691(AE016828|pid:none) Coxiella burnetii RSA 493, comp... 207 9e-52
(A2C6Z4) RecName: Full=ATP synthase subunit beta; EC=3.... 207 9e-52
FN869568_3445(FN869568|pid:none) Halomonas elongata DSM 2581, co... 207 9e-52
CP002124_1165(CP002124|pid:none) Erwinia sp. Ejp617, complete ge... 207 9e-52
(Q10Z38) RecName: Full=ATP synthase subunit beta; EC=3.... 207 9e-52
GQ330988_1(GQ330988|pid:none) Haliclona (Haliclona) sp. KJP-2009... 207 1e-51
(A7G9Q9) RecName: Full=ATP synthase subunit beta; EC=3.... 207 1e-51
(B0TWS7) RecName: Full=ATP synthase subunit beta; EC=3.... 207 1e-51
AP011177_4335(AP011177|pid:none) Shewanella violacea DSS12 DNA, ... 207 1e-51
CP001132_2731(CP001132|pid:none) Acidithiobacillus ferrooxidans ... 207 1e-51
(P41168) RecName: Full=ATP synthase subunit beta; EC=3.... 207 1e-51
(A5III3) RecName: Full=ATP synthase subunit beta; EC=3.... 207 1e-51
CP002109_3864(CP002109|pid:none) Clostridium saccharolyticum WM1... 207 1e-51
DQ403111_1(DQ403111|pid:none) Felis catus mitochondrial ATP synt... 207 1e-51
CP002351_276(CP002351|pid:none) Thermotoga thermarum DSM 5069, c... 207 1e-51
(P55988) RecName: Full=ATP synthase subunit beta; EC=3.... 207 2e-51
CP001859_1656(CP001859|pid:none) Acidaminococcus fermentans DSM ... 207 2e-51
FR872580_2355(FR872580|pid:none) Parachlamydia acanthamoebae UV7... 207 2e-51
CP001685_618(CP001685|pid:none) Leptotrichia buccalis DSM 1135, ... 207 2e-51
CP002432_2210(CP002432|pid:none) Desulfurispirillum indicum S5, ... 207 2e-51
AK362825_1(AK362825|pid:none) Hordeum vulgare subsp. vulgare mRN... 207 2e-51
(A8EV70) RecName: Full=ATP synthase subunit beta; EC=3.... 207 2e-51
AK365943_1(AK365943|pid:none) Hordeum vulgare subsp. vulgare mRN... 207 2e-51
(C4LDW0) RecName: Full=ATP synthase subunit beta; EC=3.... 207 2e-51
(Q6FYM3) RecName: Full=ATP synthase subunit beta; EC=3.... 207 2e-51
GN102175_1(GN102175|pid:none) Sequence 6956 from Patent WO200903... 207 2e-51
FP236843_4587(FP236843|pid:none) Erwinia billingiae strain Eb661... 207 2e-51
(A3QJR0) RecName: Full=ATP synthase subunit beta; EC=3.... 207 2e-51
AB206839_8(AB206839|pid:none) Acidithiobacillus ferrooxidans atp... 207 2e-51
CP002336_1047(CP002336|pid:none) Helicobacter pylori SouthAfrica... 206 2e-51
(A0Q8D9) RecName: Full=ATP synthase subunit beta; EC=3.... 206 2e-51
CP001157_5023(CP001157|pid:none) Azotobacter vinelandii DJ, comp... 206 2e-51
(B5Z8D0) RecName: Full=ATP synthase subunit beta; EC=3.... 206 2e-51
FM991728_1057(FM991728|pid:none) Helicobacter pylori B38 complet... 206 2e-51
CP002074_1048(CP002074|pid:none) Helicobacter pylori PeCan4, com... 206 2e-51
K00560_1(K00560|pid:none) yeast (s.cerevisiae) mitochondrial atp... 206 2e-51
(A6W3S8) RecName: Full=ATP synthase subunit beta 2; EC=... 206 2e-51
(A7HJV7) RecName: Full=ATP synthase subunit beta; EC=3.... 206 2e-51
CP002547_3153(CP002547|pid:none) Syntrophobotulus glycolicus DSM... 206 2e-51
(A4J999) RecName: Full=ATP synthase subunit beta; EC=3.... 206 2e-51
(Q9ZK81) RecName: Full=ATP synthase subunit beta; EC=3.... 206 2e-51
(B2VCA4) RecName: Full=ATP synthase subunit beta; EC=3.... 206 2e-51
FN598874_369(FN598874|pid:none) Helicobacter pylori B8 complete ... 206 2e-51
(C5BKJ5) RecName: Full=ATP synthase subunit beta; EC=3.... 206 2e-51
(B7IG44) RecName: Full=ATP synthase subunit beta; EC=3.... 206 3e-51
(Q9JW70) RecName: Full=ATP synthase subunit beta; EC=3.... 206 3e-51
CP001769_5023(CP001769|pid:none) Spirosoma linguale DSM 74, comp... 206 3e-51
CR940347_800(CR940347|pid:none) Theileria annulata strain Ankara... 206 3e-51
GQ330997_1(GQ330997|pid:none) Suberites sp. KJP-2009 ATP synthas... 206 3e-51
(B1KSS8) RecName: Full=ATP synthase subunit beta; EC=3.... 206 3e-51
(A8ZUA1) RecName: Full=ATP synthase subunit beta; EC=3.... 206 3e-51
(C1FQP5) RecName: Full=ATP synthase subunit beta; EC=3.... 206 3e-51
(A6QB59) RecName: Full=ATP synthase subunit beta; EC=3.... 206 3e-51
(P26527) RecName: Full=ATP synthase subunit beta; EC=3.... 206 3e-51
HM007290_1(HM007290|pid:none) Rhizoplaca chrysoleuca clone R20 A... 206 3e-51
(Q17Y78) RecName: Full=ATP synthase subunit beta; EC=3.... 206 3e-51
CP002606_977(CP002606|pid:none) Hippea maritima DSM 10411, compl... 206 3e-51
(B2UZK0) RecName: Full=ATP synthase subunit beta; EC=3.... 206 3e-51
(Q7U8U7) RecName: Full=ATP synthase subunit beta; EC=3.... 206 3e-51
(A8F3K2) RecName: Full=ATP synthase subunit beta; EC=3.... 206 3e-51
(B9L7Y7) RecName: Full=ATP synthase subunit beta; EC=3.... 206 3e-51
(A6TK65) RecName: Full=ATP synthase subunit beta; EC=3.... 206 3e-51
(B2TK00) RecName: Full=ATP synthase subunit beta; EC=3.... 206 3e-51
GN102169_1(GN102169|pid:none) Sequence 6950 from Patent WO200903... 206 3e-51
EU074273_1(EU074273|pid:none) Terebratulina retusa mitochondrial... 205 4e-51
(P29707) RecName: Full=ATP synthase subunit beta, sodium ion spe... 205 4e-51
CP001275_1178(CP001275|pid:none) Thermomicrobium roseum DSM 5159... 205 4e-51
FR695877_403(FR695877|pid:none) Uncultured Desulfobacterium sp. ... 205 4e-51
AY774529_1(AY774529|pid:none) Synthetic construct Francisella tu... 205 4e-51
CP002582_3540(CP002582|pid:none) Clostridium lentocellum DSM 542... 205 4e-51
CP002736_2542(CP002736|pid:none) Desulfotomaculum carboxydivoran... 205 4e-51
GQ330913_1(GQ330913|pid:none) Dysidea sp. KJP-2009 ATP synthase ... 205 6e-51
AY580175_1(AY580175|pid:none) Asterina miniata ATP synthase beta... 205 6e-51
AP011112_176(AP011112|pid:none) Hydrogenobacter thermophilus TK-... 205 6e-51
CP002552_335(CP002552|pid:none) Nitrosomonas sp. AL212, complete... 205 6e-51
FO082060_331(FO082060|pid:none) Methylomicrobium alcaliphilum st... 205 6e-51
(Q2YCA3) RecName: Full=ATP synthase subunit beta 1; EC=... 205 6e-51
CP003029_68(CP003029|pid:none) Rhodothermus marinus SG0.5JP17-17... 204 8e-51
AP009049_3253(AP009049|pid:none) Clostridium kluyveri NBRC 12016... 204 8e-51
(O67828) RecName: Full=ATP synthase subunit beta; EC=3.... 204 8e-51
CP002332_1094(CP002332|pid:none) Helicobacter pylori Gambia94/24... 204 8e-51
(A5GNB1) RecName: Full=ATP synthase subunit beta; EC=3.... 204 8e-51
(Q32RY8) RecName: Full=ATP synthase subunit beta, chloroplastic;... 204 8e-51
GN102165_1(GN102165|pid:none) Sequence 6946 from Patent WO200903... 204 8e-51
CP001807_73(CP001807|pid:none) Rhodothermus marinus DSM 4252, co... 204 8e-51
(Q3AHM2) RecName: Full=ATP synthase subunit beta; EC=3.... 204 8e-51
CP002573_33(CP002573|pid:none) Acidithiobacillus caldus SM-1, co... 204 8e-51
(A5N3H7) RecName: Full=ATP synthase subunit beta; EC=3.... 204 8e-51
CP002205_776(CP002205|pid:none) Sulfurimonas autotrophica DSM 16... 204 8e-51
(Q48AW0) RecName: Full=ATP synthase subunit beta; EC=3.... 204 8e-51
AP011941_256(AP011941|pid:none) Helicobacter pylori F30 DNA, com... 204 1e-50
CP002331_1064(CP002331|pid:none) Helicobacter pylori India7, com... 204 1e-50
AP011943_1067(AP011943|pid:none) Helicobacter pylori F32 DNA, co... 204 1e-50
(Q03EL4) RecName: Full=ATP synthase subunit beta; EC=3.... 204 1e-50
(A9BFX3) RecName: Full=ATP synthase subunit beta; EC=3.... 204 1e-50
CP002983_1066(CP002983|pid:none) Helicobacter pylori SNT49, comp... 204 1e-50
(A3PES6) RecName: Full=ATP synthase subunit beta; EC=3.... 204 1e-50
CP002076_1103(CP002076|pid:none) Helicobacter pylori Cuz20, comp... 204 1e-50
CP001582_1087(CP001582|pid:none) Helicobacter pylori v225d, comp... 204 1e-50
CP002209_3765(CP002209|pid:none) Ferrimonas balearica DSM 9799, ... 204 1e-50
CP002982_1108(CP002982|pid:none) Helicobacter pylori Puno135, co... 204 1e-50
(O50292) RecName: Full=ATP synthase subunit beta; EC=3.... 204 1e-50
CP002980_1038(CP002980|pid:none) Helicobacter pylori Puno120, co... 204 1e-50
(A4VS62) RecName: Full=ATP synthase subunit beta; EC=3.... 204 1e-50
(A9AVV4) RecName: Full=ATP synthase subunit beta; EC=3.... 204 1e-50
CP001072_1103(CP001072|pid:none) Helicobacter pylori Shi470, com... 204 1e-50
CP002073_1076(CP002073|pid:none) Helicobacter pylori SJM180, com... 204 1e-50
DQ087459_1(DQ087459|pid:none) Sycon lingua ATP synthase beta sub... 204 1e-50
(C1F3N6) RecName: Full=ATP synthase subunit beta; EC=3.... 204 1e-50
AE013598_719(AE013598|pid:none) Xanthomonas oryzae pv. oryzae KA... 204 1e-50
FJ827069_1(FJ827069|pid:none) Gallibacterium anatis strain Yu-ZZ... 204 1e-50
(B2SQB0) RecName: Full=ATP synthase subunit beta; EC=3.... 204 1e-50
CP002159_2880(CP002159|pid:none) Gallionella capsiferriformans E... 204 1e-50
CP003057_3733(CP003057|pid:none) Xanthomonas oryzae pv. oryzicol... 204 1e-50
CP002056_2746(CP002056|pid:none) Methylotenera versatilis 301, c... 204 1e-50
CP000815_200(CP000815|pid:none) Paulinella chromatophora chromat... 204 1e-50
(Q8PGG7) RecName: Full=ATP synthase subunit beta; EC=3.... 204 1e-50
(Q1GXN0) RecName: Full=ATP synthase subunit beta; EC=3.... 204 1e-50
FP929140_3794(FP929140|pid:none) gamma proteobacterium HdN1, com... 204 1e-50
DQ087473_1(DQ087473|pid:none) Microciona prolifera ATP synthase ... 204 1e-50
CP001931_1284(CP001931|pid:none) Thermocrinis albus DSM 14484, c... 203 2e-50
FJ707530_1(FJ707530|pid:none) Dissiliaria muelleri ATP synthase ... 203 2e-50
CP001674_2803(CP001674|pid:none) Methylovorus glucosetrophus SIP... 203 2e-50
(Q318V4) RecName: Full=ATP synthase subunit beta; EC=3.... 203 2e-50
CP003093_2736(CP003093|pid:none) Pseudoxanthomonas spadix BD-a59... 203 2e-50
FP929052_640(FP929052|pid:none) Ruminococcus sp. 18P13 draft gen... 203 2e-50
CP002738_4387(CP002738|pid:none) Methylomonas methanica MC09, co... 203 2e-50
(Q7VA76) RecName: Full=ATP synthase subunit beta; EC=3.... 203 2e-50
GQ464994_1(GQ464994|pid:none) Gallibacterium anatis strain Yu-ZM... 203 2e-50
FP929044_2114(FP929044|pid:none) Eubacterium siraeum 70/3 draft ... 203 2e-50
(Q11Y90) RecName: Full=ATP synthase subunit beta; EC=3.... 203 2e-50
(Q82XP8) RecName: Full=ATP synthase subunit beta; EC=3.... 203 2e-50
FP929061_1945(FP929061|pid:none) Clostridiales sp. SSC/2 draft g... 203 2e-50
AY580244_1(AY580244|pid:none) Metridium senile ATP synthase beta... 203 2e-50
CP001220_336(CP001220|pid:none) Comamonas testosteroni CNB-2, co... 202 3e-50
(Q21DK8) RecName: Full=ATP synthase subunit beta; EC=3.... 202 3e-50
CP001796_3058(CP001796|pid:none) Pseudoalteromonas sp. SM9913 ch... 202 3e-50
CP001055_1501(CP001055|pid:none) Elusimicrobium minutum Pei191, ... 202 3e-50
HM859881_1(HM859881|pid:none) Cinachyrella alloclada ATP synthas... 202 3e-50
DQ403095_1(DQ403095|pid:none) Didelphis virginiana mitochondrial... 202 3e-50
(Q0AJB0) RecName: Full=ATP synthase subunit beta 1; EC=... 202 3e-50
(Q3IK50) RecName: Full=ATP synthase subunit beta; EC=3.... 202 3e-50
CP001104_1426(CP001104|pid:none) Eubacterium eligens ATCC 27750,... 202 4e-50
(Q0AUD3) RecName: Full=ATP synthase subunit beta; EC=3.... 202 4e-50
CP001978_3679(CP001978|pid:none) Marinobacter adhaerens HP15, co... 202 4e-50
(B8D6S7) RecName: Full=ATP synthase subunit beta; EC=3.... 202 4e-50
AY296243_1(AY296243|pid:none) Actinobacillus rossii ATP synthase... 202 4e-50
CP001034_2792(CP001034|pid:none) Natranaerobius thermophilus JW/... 202 4e-50
FP929049_2876(FP929049|pid:none) Roseburia intestinalis M50/1 dr... 202 4e-50
(Q07232) RecName: Full=ATP synthase subunit beta; EC=3.... 202 5e-50
(B0U598) RecName: Full=ATP synthase subunit beta; EC=3.... 202 5e-50
DQ859784_1(DQ859784|pid:none) Ewingella americana strain ICMP 15... 202 5e-50
FR799578_120(FR799578|pid:none) Leishmania mexicana MHOM/GT/2001... 202 5e-50
CP001720_3868(CP001720|pid:none) Desulfotomaculum acetoxidans DS... 202 5e-50
(Q9PE85) RecName: Full=ATP synthase subunit beta; EC=3.... 202 5e-50
AM502243_123(AM502243|pid:none) Leishmania infantum chromosome 2... 202 5e-50
CP002599_90(CP002599|pid:none) Burkholderia gladioli BSR3 chromo... 202 5e-50
CP000012_1003(CP000012|pid:none) Helicobacter pylori 51, complet... 202 5e-50
>BT127859_1(BT127859|pid:none) Dendroctonus ponderosae clone
DPO123_G12 unknown mRNA.
Length = 515
Score = 233 bits (594), Expect = 2e-59
Identities = 119/159 (74%), Positives = 132/159 (83%)
Frame = +3
Query: 639 DPAPATTFAHLDATTVLSRAISELGIYPCVDPLDSTSLMMDPNIIGVEHYKVATDVQKIL 818
DPAPATTFAHLDATTVLSRAI+ELGIYP VDPLDSTS +MDPNIIG EHY +A VQKIL
Sbjct: 357 DPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIIGQEHYNIARGVQKIL 416
Query: 819 QEYKSLQDIIAILGMDDLSEDQKATVFRARKIQRFLSQPFEVAHAFTNMEGRFVKLSDSI 998
Q+YKSLQDIIAILGMD+LSED K TV RARKIQRFLSQPF+VA FT G+ V L ++I
Sbjct: 417 QDYKSLQDIIAILGMDELSEDDKLTVARARKIQRFLSQPFQVAEVFTGHPGKLVPLEETI 476
Query: 999 KAFKGILEGKYDHLPEAAFYMVGGIEDVEIKAAKLLESA 1115
K F+ IL G YDHLPE AFYMVG IE+V KA KL E++
Sbjct: 477 KGFQKILGGDYDHLPEVAFYMVGPIEEVVQKAEKLAETS 515
Score = 75.9 bits (185), Expect = 5e-12
Identities = 57/146 (39%), Positives = 76/146 (52%)
Frame = +2
Query: 188 YFEKNKSLLDKESNEESTEVDYSKLNENQGVVHQVIGAVVDVYFPHGKLPYINDALIVDD 367
+F++N++L K + ++ +G + VIGAVVDV F LP I +AL V
Sbjct: 31 HFQQNRTLAAKAAAGQA-----------KGRIVAVIGAVVDVQF-EDDLPPILNALEVA- 77
Query: 368 FQAENVEKVIEDLNNPSLKGKIDFNNVPISNIKLVLEVAQHLGDGIVRCVALDITDGLXR 547
N P +LVLEVAQHLG+ VR +A+D T+GL R
Sbjct: 78 ------------------------NRSP----RLVLEVAQHLGENTVRTIAMDGTEGLVR 109
Query: 548 GALVLNTGSPLMVPVGQATLGRIMNV 625
G VL+TG P+ +PVG TLGRIMNV
Sbjct: 110 GQNVLDTGYPIRIPVGVETLGRIMNV 135
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 5349213
Number of Hits to DB: 3,415,944,539
Number of extensions: 67648221
Number of successful extensions: 207992
Number of sequences better than 10.0: 5330
Number of HSP's gapped: 205375
Number of HSP's successfully gapped: 9089
Length of query: 461
Length of database: 1,732,582,204
Length adjustment: 135
Effective length of query: 326
Effective length of database: 1,010,438,449
Effective search space: 329402934374
Effective search space used: 329402934374
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)
Dictyostelium discoideum cDNA Project Home