Homology VHK609 vs Protein

Query= VHK609 (VHK609Q) /CSM/VH/VHK6-A/VHK609Q.Seq.d/
         (1383 letters)

Database: nrp_B
           5,349,213 sequences; 1,732,582,204 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT127859_1(BT127859|pid:none) Dendroctonus ponderosae clone DPO1...   233   2e-59
AK159737_1(AK159737|pid:none) Mus musculus osteoclast-like cell ...   232   3e-59
(Q5ZLC5) RecName: Full=ATP synthase subunit beta, mitochondrial;...   231   6e-59
(P38482) RecName: Full=ATP synthase subunit beta, mitochondrial;...   231   6e-59
BC067388_1(BC067388|pid:none) Xenopus tropicalis ATP synthase, H...   231   8e-59
BC037127_1(BC037127|pid:none) Mus musculus ATP synthase, H+ tran...   231   1e-58
(P72247) RecName: Full=ATP synthase subunit beta;          EC=3....   231   1e-58
AK166603_1(AK166603|pid:none) Mus musculus 4 days embryo whole b...   231   1e-58
(Q3U774) RecName: Full=ATP synthase subunit beta, mitochondrial;...   231   1e-58
(P10719) RecName: Full=ATP synthase subunit beta, mitochondrial;...   230   1e-58
A28701(A28701;S70510)H+-transporting two-sector ATPase (EC 3.6.3...   230   1e-58
DQ443322_1(DQ443322|pid:none) Bombyx mori H+ transporting ATP sy...   230   1e-58
DQ443321_1(DQ443321|pid:none) Bombyx mori H+ transporting ATP sy...   230   1e-58
AK167764_1(AK167764|pid:none) Mus musculus TIB-55 BB88 cDNA, RIK...   230   2e-58
GN102155_1(GN102155|pid:none) Sequence 6936 from Patent WO200903...   230   2e-58
HM156739_1(HM156739|pid:none) Helicoverpa zea ATP synthase mRNA,...   230   2e-58
(Q162S9) RecName: Full=ATP synthase subunit beta;          EC=3....   230   2e-58
(Q9PTY0) RecName: Full=ATP synthase subunit beta, mitochondrial;...   230   2e-58
D00022_1(D00022|pid:none) Homo sapiens mRNA for F1 beta subunit,...   229   2e-58
FJ208948_1(FJ208948|pid:none) Gillichthys mirabilis F1 ATP synth...   229   2e-58
BT120312_1(BT120312|pid:none) Drosophila melanogaster RE21838 fu...   229   2e-58
X05606_1(X05606|pid:none) Human mRNA fragment for ATP synthetase...   229   2e-58
(P06576) RecName: Full=ATP synthase subunit beta, mitochondrial;...   229   2e-58
(Q05825) RecName: Full=ATP synthase subunit beta, mitochondrial;...   229   2e-58
X05605_1(X05605|pid:none) Bovine mRNA fragment for ATP synthetas...   229   3e-58
(P00829) RecName: Full=ATP synthase subunit beta, mitochondrial;...   229   3e-58
BC124410_1(BC124410|pid:none) Danio rerio zgc:163069, mRNA (cDNA...   229   3e-58
AB104883_1(AB104883|pid:none) Zygosaccharomyces rouxii ZrATP2 ge...   229   3e-58
FN392320_1159(FN392320|pid:none) Pichia pastoris GS115 chromosom...   229   3e-58
(P49376) RecName: Full=ATP synthase subunit beta, mitochondrial;...   229   3e-58
BC046741_1(BC046741|pid:none) Xenopus laevis ATP synthase, H+ tr...   229   3e-58
AK151081_1(AK151081|pid:none) Mus musculus bone marrow macrophag...   229   4e-58
EZ424166_1(EZ424166|pid:none) TSA: Glossina morsitans morsitans ...   229   4e-58
(Q3YS09) RecName: Full=ATP synthase subunit beta;          EC=3....   229   4e-58
CP002347_1578(CP002347|pid:none) Calditerrivibrio nitroreducens ...   228   5e-58
CP002897_1144(CP002897|pid:none) Paracoccus denitrificans SD1, c...   228   5e-58
AB603754_1(AB603754|pid:none) Mesocricetus auratus atp5b mRNA fo...   228   5e-58
DQ440233_1(DQ440233|pid:none) Aedes aegypti clone AET-272 F0F1-t...   228   6e-58
CP002503_187(CP002503|pid:none) Eremothecium cymbalariae DBVPG#7...   228   6e-58
GN102063_1(GN102063|pid:none) Sequence 6844 from Patent WO200903...   228   6e-58
AY312637_1(AY312637|pid:none) Drosophila simulans strain DsimSey...   228   6e-58
GN102557_1(GN102557|pid:none) Sequence 7338 from Patent WO200903...   228   8e-58
FP929003_363(FP929003|pid:none) Candidatus Nitrospira defluvii c...   228   8e-58
CP000498_39(CP000498|pid:none) Scheffersomyces stipitis CBS 6054...   227   1e-57
AF030559_1(AF030559|pid:none) Mus musculus ATP synthase beta-sub...   227   1e-57
(Q11DD5) RecName: Full=ATP synthase subunit beta;          EC=3....   226   2e-57
CU928176_67(CU928176|pid:none) Zygosaccharomyces rouxii strain C...   226   2e-57
(Q01859) RecName: Full=ATP synthase subunit beta, mitochondrial;...   226   3e-57
EF148198_1(EF148198|pid:none) Populus trichocarpa clone WS0128_K...   226   3e-57
(A8LJR4) RecName: Full=ATP synthase subunit beta 2;          EC=...   225   4e-57
AJ843974_1(AJ843974|pid:none) Plantago major partial mRNA for mi...   225   5e-57
AP008207_2168(AP008207|pid:none) Oryza sativa (japonica cultivar...   225   5e-57
CP002018_455(CP002018|pid:none) Ketogulonigenium vulgarum WSH-00...   225   5e-57
GN102563_1(GN102563|pid:none) Sequence 7344 from Patent WO200903...   225   5e-57
GN102555_1(GN102555|pid:none) Sequence 7336 from Patent WO200903...   225   5e-57
CP000613_2186(CP000613|pid:none) Rhodospirillum centenum SW, com...   225   5e-57
GN102561_1(GN102561|pid:none) Sequence 7342 from Patent WO200903...   225   5e-57
AJ870436_1(AJ870436|pid:none) Polytomella sp. Pringsheim 198.80 ...   225   5e-57
AP010803_2685(AP010803|pid:none) Sphingobium japonicum UT26S DNA...   224   7e-57
EF085070_1(EF085070|pid:none) Picea sitchensis clone WS02728_O12...   224   7e-57
(P43395) RecName: Full=ATP synthase subunit beta, mitochondrial;...   224   7e-57
(B6JD09) RecName: Full=ATP synthase subunit beta;          EC=3....   224   7e-57
EU401720_1(EU401720|pid:none) Litopenaeus vannamei F1-ATP syntha...   224   7e-57
GN102565_1(GN102565|pid:none) Sequence 7346 from Patent WO200903...   224   9e-57
GN102059_1(GN102059|pid:none) Sequence 6840 from Patent WO200903...   224   9e-57
M19483_1(M19483|pid:none) Human ATP synthase beta subunit gene, ...   224   9e-57
DQ358698_1(DQ358698|pid:none) Pinctada fucata ATP synthase beta ...   224   9e-57
(A9H9A8) RecName: Full=ATP synthase subunit beta;          EC=3....   224   9e-57
CR382128_148(CR382128|pid:none) Yarrowia lipolytica strain CLIB1...   224   9e-57
(Q1RKD7) RecName: Full=ATP synthase subunit beta;          EC=3....   224   1e-56
(C0R5I6) RecName: Full=ATP synthase subunit beta;          EC=3....   224   1e-56
AP012206_402(AP012206|pid:none) Bradyrhizobium japonicum USDA 6 ...   224   1e-56
FN319667_1(FN319667|pid:none) Schistosoma japonicum isolate Anhu...   223   2e-56
(P46561) RecName: Full=ATP synthase subunit beta, mitochondrial;...   223   2e-56
FJ605485_1(FJ605485|pid:none) Procambarus clarkii F1F0-ATP synth...   223   2e-56
AK364060_1(AK364060|pid:none) Hordeum vulgare subsp. vulgare mRN...   223   2e-56
FN319664_1(FN319664|pid:none) Schistosoma japonicum isolate Anhu...   223   2e-56
CP002029_93(CP002029|pid:none) Campylobacter jejuni subsp. jejun...   223   2e-56
(A1VXJ0) RecName: Full=ATP synthase subunit beta;          EC=3....   223   2e-56
FJ042670_1(FJ042670|pid:none) Fenneropenaeus chinensis F1F0-ATP ...   223   2e-56
D10491_1(D10491|pid:none) Oryza sativa Japonica Group atpB gene ...   223   2e-56
(A7ZC37) RecName: Full=ATP synthase subunit beta;          EC=3....   223   2e-56
(B0THN2) RecName: Full=ATP synthase subunit beta;          EC=3....   223   3e-56
AE017346_61(AE017346|pid:none) Cryptococcus neoformans var. neof...   223   3e-56
CP002083_3369(CP002083|pid:none) Hyphomicrobium denitrificans AT...   222   3e-56
CP001016_215(CP001016|pid:none) Beijerinckia indica subsp. indic...   222   3e-56
(A4WUM7) RecName: Full=ATP synthase subunit beta;          EC=3....   222   3e-56
(A4YKE0) RecName: Full=ATP synthase subunit beta;          EC=3....   222   5e-56
GN102123_1(GN102123|pid:none) Sequence 6904 from Patent WO200903...   222   5e-56
(Q2VZN2) RecName: Full=ATP synthase subunit beta;          EC=3....   222   5e-56
CP000683_877(CP000683|pid:none) Rickettsia massiliae MTU5, compl...   222   5e-56
(Q73IG3) RecName: Full=ATP synthase subunit beta;          EC=3....   222   5e-56
(Q2G5N5) RecName: Full=ATP synthase subunit beta;          EC=3....   222   5e-56
(A5E950) RecName: Full=ATP synthase subunit beta 1;          EC=...   222   5e-56
GN102197_1(GN102197|pid:none) Sequence 6978 from Patent WO200903...   221   6e-56
(Q68VU8) RecName: Full=ATP synthase subunit beta;          EC=3....   221   6e-56
(A8GY40) RecName: Full=ATP synthase subunit beta;          EC=3....   221   6e-56
(P17614) RecName: Full=ATP synthase subunit beta, mitochondrial;...   221   6e-56
CP003075_3118(CP003075|pid:none) Pelagibacterium halotolerans B2...   221   6e-56
GN102239_1(GN102239|pid:none) Sequence 7020 from Patent WO200903...   221   6e-56
(B3CN17) RecName: Full=ATP synthase subunit beta;          EC=3....   221   6e-56
(P83483) RecName: Full=ATP synthase subunit beta-1, mitochondria...   221   8e-56
AP012159_1411(AP012159|pid:none) Gluconacetobacter xylinus NBRC ...   221   8e-56
BT000796_1(BT000796|pid:none) Arabidopsis thaliana unknown prote...   221   8e-56
CP002688_1055(CP002688|pid:none) Arabidopsis thaliana chromosome...   221   8e-56
AK359072_1(AK359072|pid:none) Hordeum vulgare subsp. vulgare mRN...   221   8e-56
(A8GPZ4) RecName: Full=ATP synthase subunit beta;          EC=3....   221   8e-56
(Q89X74) RecName: Full=ATP synthase subunit beta;          EC=3....   221   8e-56
AJ271468_1(AJ271468|pid:none) Arabidopsis thaliana mRNA for mito...   221   8e-56
CP002279_1197(CP002279|pid:none) Mesorhizobium opportunistum WSM...   221   8e-56
AK229974_1(AK229974|pid:none) Arabidopsis thaliana mRNA for H+-t...   221   8e-56
(P83484) RecName: Full=ATP synthase subunit beta-2, mitochondria...   221   8e-56
AP011529_1840(AP011529|pid:none) Deferribacter desulfuricans SSM...   221   8e-56
AP011121_117(AP011121|pid:none) Acetobacter pasteurianus IFO 328...   221   1e-55
(A8F004) RecName: Full=ATP synthase subunit beta;          EC=3....   221   1e-55
(A5VSE1) RecName: Full=ATP synthase subunit beta;          EC=3....   221   1e-55
GQ922833_1(GQ922833|pid:none) Pseudozyma flocculosa ATP synthase...   221   1e-55
GN102065_1(GN102065|pid:none) Sequence 6846 from Patent WO200903...   221   1e-55
(A3PIB9) RecName: Full=ATP synthase subunit beta 1;          EC=...   221   1e-55
CP002447_1168(CP002447|pid:none) Mesorhizobium ciceri biovar bis...   220   1e-55
CP001280_337(CP001280|pid:none) Methylocella silvestris BL2, com...   220   1e-55
GN102205_1(GN102205|pid:none) Sequence 6986 from Patent WO200903...   220   1e-55
CP001349_7065(CP001349|pid:none) Methylobacterium nodulans ORS 2...   220   1e-55
(Q2YLE6) RecName: Full=ATP synthase subunit beta;          EC=3....   220   1e-55
CP002355_757(CP002355|pid:none) Sulfuricurvum kujiense DSM 16994...   220   2e-55
(P42469) RecName: Full=ATP synthase subunit beta;          EC=3....   220   2e-55
CP001751_1844(CP001751|pid:none) Candidatus Puniceispirillum mar...   219   2e-55
CP002271_938(CP002271|pid:none) Stigmatella aurantiaca DW4/3-1, ...   219   2e-55
(A7HIX7) RecName: Full=ATP synthase subunit beta;          EC=3....   219   3e-55
(Q13DP2) RecName: Full=ATP synthase subunit beta;          EC=3....   219   3e-55
DQ674545_1(DQ674545|pid:none) Coccidioides posadasii ATP synthas...   219   3e-55
(Q0BQE8) RecName: Full=ATP synthase subunit beta;          EC=3....   219   4e-55
CP002131_1943(CP002131|pid:none) Thermosediminibacter oceani DSM...   219   4e-55
(Q25117) RecName: Full=ATP synthase subunit beta, mitochondrial;...   219   4e-55
AP007175_411(AP007175|pid:none) Aspergillus oryzae RIB40 DNA, SC...   219   4e-55
AC144731_35(AC144731|pid:none) Medicago truncatula clone mth2-5g...   219   4e-55
(O50290) RecName: Full=ATP synthase subunit beta;          EC=3....   218   5e-55
CP001584_852(CP001584|pid:none) Rickettsia prowazekii Rp22, comp...   218   5e-55
(Q3SVJ1) RecName: Full=ATP synthase subunit beta;          EC=3....   218   5e-55
(B0SDA5) RecName: Full=ATP synthase subunit beta;          EC=3....   218   5e-55
(Q1MAZ2) RecName: Full=ATP synthase subunit beta;          EC=3....   218   7e-55
AB266032_1(AB266032|pid:none) Dicyema acuticephalum gene for ATP...   218   7e-55
(A6WXX1) RecName: Full=ATP synthase subunit beta;          EC=3....   218   9e-55
AP012035_1725(AP012035|pid:none) Acidiphilium multivorum AIU301 ...   218   9e-55
AE017321_685(AE017321|pid:none) Wolbachia endosymbiont strain TR...   218   9e-55
AK374834_1(AK374834|pid:none) Hordeum vulgare subsp. vulgare mRN...   217   1e-54
(B0T335) RecName: Full=ATP synthase subunit beta;          EC=3....   217   1e-54
CP002085_285(CP002085|pid:none) Desulfarculus baarsii DSM 2075, ...   217   1e-54
CP003008_543(CP003008|pid:none) Myceliophthora thermophila ATCC ...   217   1e-54
(A1ALL7) RecName: Full=ATP synthase subunit beta 1;          EC=...   217   1e-54
CP002330_1226(CP002330|pid:none) Caldicellulosiruptor kronotskye...   217   1e-54
CP003001_747(CP003001|pid:none) Caldicellulosiruptor lactoacetic...   217   1e-54
(B3EA01) RecName: Full=ATP synthase subunit beta;          EC=3....   217   1e-54
(Q5PAN2) RecName: Full=ATP synthase subunit beta;          EC=3....   217   1e-54
CP001079_454(CP001079|pid:none) Anaplasma marginale str. Florida...   217   1e-54
GU292799_1(GU292799|pid:none) Miniopterus fuliginosus mitochondr...   217   1e-54
CP002304_379(CP002304|pid:none) Halanaerobium hydrogeniformans, ...   216   2e-54
(C3M9S1) RecName: Full=ATP synthase subunit beta;          EC=3....   216   2e-54
(Q0AKW0) RecName: Full=ATP synthase subunit beta;          EC=3....   216   2e-54
CP001131_4443(CP001131|pid:none) Anaeromyxobacter sp. K, complet...   216   2e-54
CU638744_194(CU638744|pid:none) Podospora anserina S mat+ genomi...   216   2e-54
(C4K227) RecName: Full=ATP synthase subunit beta;          EC=3....   216   2e-54
CP001896_46(CP001896|pid:none) Allochromatium vinosum DSM 180, c...   216   2e-54
CP001968_856(CP001968|pid:none) Denitrovibrio acetiphilus DSM 12...   216   3e-54
FM162591_36(FM162591|pid:none) Photorhabdus asymbiotica ATCC4394...   216   3e-54
CP000633_3010(CP000633|pid:none) Agrobacterium vitis S4 chromoso...   216   3e-54
GN102129_1(GN102129|pid:none) Sequence 6910 from Patent WO200903...   216   3e-54
CP002829_1507(CP002829|pid:none) Thermodesulfobacterium sp. OPB4...   216   3e-54
AE006914_1235(AE006914|pid:none) Rickettsia conorii str. Malish ...   216   3e-54
CP002480_1127(CP002480|pid:none) Granulicella sp. MP5ACTX9, comp...   216   3e-54
CP002912_1166(CP002912|pid:none) Rickettsia heilongjiangensis 05...   216   3e-54
(C3PLT1) RecName: Full=ATP synthase subunit beta;          EC=3....   216   3e-54
(A8GTS6) RecName: Full=ATP synthase subunit beta;          EC=3....   216   3e-54
CP000766_1244(CP000766|pid:none) Rickettsia rickettsii str. Iowa...   216   3e-54
(P05038) RecName: Full=ATP synthase subunit beta;          EC=3....   216   3e-54
DQ403107_1(DQ403107|pid:none) Homo sapiens mitochondrial ATP syn...   216   3e-54
CP001622_3870(CP001622|pid:none) Rhizobium leguminosarum bv. tri...   216   3e-54
M12082_1(M12082|pid:none) Yeast (S.cerevisiae) nuclear ATP2 gene...   216   3e-54
CP000628_3248(CP000628|pid:none) Agrobacterium radiobacter K84 c...   215   4e-54
(Q1QQS8) RecName: Full=ATP synthase subunit beta;          EC=3....   215   4e-54
GN102053_1(GN102053|pid:none) Sequence 6834 from Patent WO200903...   215   4e-54
(A1RQB0) RecName: Full=ATP synthase subunit beta;          EC=3....   215   6e-54
(Q7NA94) RecName: Full=ATP synthase subunit beta;          EC=3....   215   6e-54
Y15178_1(Y15178|pid:none) Sorghum bicolor F1-ATP synthase, culti...   215   6e-54
CP002511_489(CP002511|pid:none) Candidatus Pelagibacter sp. IMCC...   215   6e-54
FP929064_427(FP929064|pid:none) Leptosphaeria maculans JN3 lm_Su...   215   6e-54
(Q1IIG8) RecName: Full=ATP synthase subunit beta;          EC=3....   214   7e-54
CP002431_3072(CP002431|pid:none) Desulfovibrio aespoeensis Aspo-...   214   7e-54
AM910996_536(AM910996|pid:none) Plasmodium knowlesi strain H chr...   214   7e-54
CP001104_1871(CP001104|pid:none) Eubacterium eligens ATCC 27750,...   214   7e-54
(B3EJK9) RecName: Full=ATP synthase subunit beta;          EC=3....   214   7e-54
AF025802_1(AF025802|pid:none) Drosophila subobscura ATP synthase...   214   1e-53
FP565176_2845(FP565176|pid:none) Xanthomonas albilineans str. GP...   214   1e-53
(Q6CYJ5) RecName: Full=ATP synthase subunit beta;          EC=3....   214   1e-53
(A4Y187) RecName: Full=ATP synthase subunit beta;          EC=3....   214   1e-53
AY897519_1(AY897519|pid:none) Wolbachia endosymbiont of Drosophi...   214   1e-53
AM270321_1(AM270321|pid:none) Aspergillus niger contig An14c0140...   214   1e-53
CP001574_443(CP001574|pid:none) Micromonas sp. RCC299 chromosome...   214   1e-53
CP002727_4443(CP002727|pid:none) Pseudomonas fulva 12-X, complet...   214   1e-53
CP000908_1438(CP000908|pid:none) Methylobacterium extorquens PA1...   214   1e-53
(Q5FRC5) RecName: Full=ATP synthase subunit beta 1;          EC=...   214   1e-53
AP010946_2492(AP010946|pid:none) Azospirillum sp. B510 DNA, comp...   214   1e-53
(C3K1E6) RecName: Full=ATP synthase subunit beta;          EC=3....   214   1e-53
CP001707_2613(CP001707|pid:none) Kangiella koreensis DSM 16069, ...   214   1e-53
(C6DJH2) RecName: Full=ATP synthase subunit beta;          EC=3....   214   1e-53
GN102167_1(GN102167|pid:none) Sequence 6948 from Patent WO200903...   214   1e-53
CP001108_50(CP001108|pid:none) Prosthecochloris aestuarii DSM 27...   213   2e-53
(Q313W0) RecName: Full=ATP synthase subunit beta;          EC=3....   213   2e-53
CP002585_6078(CP002585|pid:none) Pseudomonas brassicacearum subs...   213   2e-53
(Q65Q07) RecName: Full=ATP synthase subunit beta;          EC=3....   213   2e-53
FR823389_184(FR823389|pid:none) Neospora caninum Liverpool compl...   213   2e-53
(Q87TT4) RecName: Full=ATP synthase subunit beta;          EC=3....   213   2e-53
CP002780_3581(CP002780|pid:none) Desulfotomaculum ruminis DSM 21...   213   2e-53
DQ228960_1(DQ228960|pid:none) Toxoplasma gondii mitochondrial F1...   213   2e-53
(A3DAR4) RecName: Full=ATP synthase subunit beta;          EC=3....   213   2e-53
(B3PQ68) RecName: Full=ATP synthase subunit beta;          EC=3....   213   2e-53
(Q48BG5) RecName: Full=ATP synthase subunit beta;          EC=3....   213   2e-53
(A7I177) RecName: Full=ATP synthase subunit beta;          EC=3....   213   2e-53
(A1VFJ5) RecName: Full=ATP synthase subunit beta;          EC=3....   213   2e-53
FR824232_13(FR824232|pid:none) Albugo laibachii Nc14, genomic co...   213   2e-53
CP000096_21(CP000096|pid:none) Chlorobium luteolum DSM 273, comp...   213   2e-53
CP002246_3926(CP002246|pid:none) Yersinia enterocolitica subsp. ...   213   2e-53
FP565575_2881(FP565575|pid:none) Candidatus Methylomirabilis oxy...   213   2e-53
(A0LLF8) RecName: Full=ATP synthase subunit beta;          EC=3....   213   2e-53
(A4TSJ3) RecName: Full=ATP synthase subunit beta;          EC=3....   213   2e-53
AM920436_1007(AM920436|pid:none) Penicillium chrysogenum Wiscons...   213   2e-53
CP001593_3534(CP001593|pid:none) Yersinia pestis Z176003, comple...   213   2e-53
(A8G1W5) RecName: Full=ATP synthase subunit beta;          EC=3....   213   3e-53
(A8HAG3) RecName: Full=ATP synthase subunit beta;          EC=3....   213   3e-53
FJ599948_1(FJ599948|pid:none) Pfiesteria piscicida clone Ppi+Rho...   213   3e-53
GN102127_1(GN102127|pid:none) Sequence 6908 from Patent WO200903...   213   3e-53
CP002505_4369(CP002505|pid:none) Rahnella sp. Y9602, complete ge...   213   3e-53
(Q8KAC9) RecName: Full=ATP synthase subunit beta 2;          EC=...   213   3e-53
(Q07VU4) RecName: Full=ATP synthase subunit beta 1;          EC=...   213   3e-53
(B0UWG5) RecName: Full=ATP synthase subunit beta;          EC=3....   213   3e-53
AF283808_8(AF283808|pid:none) Clostridium pasteurianum atp opero...   212   4e-53
(A1AHR4) RecName: Full=ATP synthase subunit beta;          EC=3....   212   4e-53
(Q1MRB8) RecName: Full=ATP synthase subunit beta;          EC=3....   212   4e-53
CP002890_4483(CP002890|pid:none) Escherichia coli UMNF18, comple...   212   4e-53
(Q329S1) RecName: Full=ATP synthase subunit beta;          EC=3....   212   4e-53
(A8A6J5) RecName: Full=ATP synthase subunit beta;          EC=3....   212   4e-53
(Q3K441) RecName: Full=ATP synthase subunit beta;          EC=3....   212   4e-53
(Q2K3H0) RecName: Full=ATP synthase subunit beta;          EC=3....   212   4e-53
(B1I6J7) RecName: Full=ATP synthase subunit beta;          EC=3....   212   4e-53
(B4F0E7) RecName: Full=ATP synthase subunit beta;          EC=3....   212   4e-53
(A5WBW1) RecName: Full=ATP synthase subunit beta;          EC=3....   212   5e-53
(Q24MP1) RecName: Full=ATP synthase subunit beta;          EC=3....   212   5e-53
AF188265_8(AF188265|pid:none) Salmonella typhimurium strain TA98...   212   5e-53
(A1SBU0) RecName: Full=ATP synthase subunit beta;          EC=3....   212   5e-53
(Q2RFX9) RecName: Full=ATP synthase subunit beta;          EC=3....   212   5e-53
FQ790286_270(FQ790286|pid:none) Botryotinia fuckeliana isolate T...   212   5e-53
FN645454_1262(FN645454|pid:none) Bartonella clarridgeiae strain ...   211   6e-53
(A5CDA5) RecName: Full=ATP synthase subunit beta;          EC=3....   211   6e-53
CP002005_382(CP002005|pid:none) Moraxella catarrhalis RH4, compl...   211   6e-53
AB003549_1(AB003549|pid:none) Pisum sativum mRNA for F1 ATPase, ...   211   6e-53
CP002824_1418(CP002824|pid:none) Enterobacter aerogenes KCTC 219...   211   6e-53
(C6E9F1) RecName: Full=ATP synthase subunit beta;          EC=3....   211   6e-53
(B5EFI7) RecName: Full=ATP synthase subunit beta;          EC=3....   211   6e-53
CP001918_5103(CP001918|pid:none) Enterobacter cloacae subsp. clo...   211   6e-53
(A6VL57) RecName: Full=ATP synthase subunit beta;          EC=3....   211   8e-53
FN645467_51(FN645467|pid:none) Bartonella rochalimae ATCC BAA-14...   211   8e-53
(A1BCJ2) RecName: Full=ATP synthase subunit beta;          EC=3....   211   8e-53
(B5RFW3) RecName: Full=ATP synthase subunit beta;          EC=3....   211   8e-53
(A8ACN6) RecName: Full=ATP synthase subunit beta;          EC=3....   211   8e-53
CP001785_82(CP001785|pid:none) Ammonifex degensii KC4, complete ...   211   8e-53
(B8FZ34) RecName: Full=ATP synthase subunit beta;          EC=3....   211   8e-53
(P42465) RecName: Full=ATP synthase subunit beta;          EC=3....   211   8e-53
GQ330912_1(GQ330912|pid:none) Darwinella muelleri ATP synthase b...   211   8e-53
(A9IYW6) RecName: Full=ATP synthase subunit beta;          EC=3....   211   8e-53
FJ555372_1(FJ555372|pid:none) Brachionus plicatilis ATP synthase...   211   8e-53
FN543093_10(FN543093|pid:none) Cronobacter turicensis z3032 comp...   211   8e-53
(B3CRK6) RecName: Full=ATP synthase subunit beta;          EC=3....   211   8e-53
(A9MJR9) RecName: Full=ATP synthase subunit beta;          EC=3....   211   8e-53
(A7MMW9) RecName: Full=ATP synthase subunit beta;          EC=3....   211   8e-53
(B1JFU1) RecName: Full=ATP synthase subunit beta;          EC=3....   211   1e-52
CP001798_3734(CP001798|pid:none) Nitrosococcus halophilus Nc4, c...   211   1e-52
(B0KRA8) RecName: Full=ATP synthase subunit beta;          EC=3....   211   1e-52
(Q04S18) RecName: Full=ATP synthase subunit beta;          EC=3....   211   1e-52
CP002364_2594(CP002364|pid:none) Desulfobulbus propionicus DSM 2...   211   1e-52
(Q1CX36) RecName: Full=ATP synthase subunit beta;          EC=3....   211   1e-52
(Q0QEP2) RecName: Full=ATP synthase subunit beta, mitochondrial;...   211   1e-52
FN543502_3933(FN543502|pid:none) Citrobacter rodentium ICC168, c...   211   1e-52
(B2FHY8) RecName: Full=ATP synthase subunit beta;          EC=3....   210   1e-52
GN102397_1(GN102397|pid:none) Sequence 7178 from Patent WO200903...   210   1e-52
(A5EXL4) RecName: Full=ATP synthase subunit beta;          EC=3....   210   1e-52
(Q72SX9) RecName: Full=ATP synthase subunit beta;          EC=3....   210   1e-52
CP003026_4387(CP003026|pid:none) Enterobacter asburiae LF7a, com...   210   1e-52
GQ330991_1(GQ330991|pid:none) Haliclona sp. KJP-2009 ATP synthas...   210   1e-52
CP001277_2092(CP001277|pid:none) Candidatus Hamiltonella defensa...   210   1e-52
CP002986_3529(CP002986|pid:none) Stenotrophomonas maltophilia JV...   210   1e-52
(A4WGF5) RecName: Full=ATP synthase subunit beta;          EC=3....   210   1e-52
(Q4FQ37) RecName: Full=ATP synthase subunit beta;          EC=3....   210   1e-52
GN102159_1(GN102159|pid:none) Sequence 6940 from Patent WO200903...   210   2e-52
FN645485_151(FN645485|pid:none) Bartonella sp. AR 15-3 contig18,...   210   2e-52
CP001654_3927(CP001654|pid:none) Dickeya dadantii Ech703, comple...   210   2e-52
(Q67TB7) RecName: Full=ATP synthase subunit beta;          EC=3....   209   2e-52
(A7IH31) RecName: Full=ATP synthase subunit beta;          EC=3....   209   2e-52
CP002526_4213(CP002526|pid:none) Glaciecola sp. 4H-3-7+YE-5, com...   209   2e-52
DQ403114_1(DQ403114|pid:none) Diceros bicornis mitochondrial ATP...   209   3e-52
(A1UR49) RecName: Full=ATP synthase subunit beta;          EC=3....   209   3e-52
(A3M144) RecName: Full=ATP synthase subunit beta;          EC=3....   209   3e-52
(Q1I2I7) RecName: Full=ATP synthase subunit beta;          EC=3....   209   3e-52
(A0L2S8) RecName: Full=ATP synthase subunit beta;          EC=3....   209   3e-52
CP001607_1869(CP001607|pid:none) Aggregatibacter aphrophilus NJ8...   209   3e-52
(B4SAN6) RecName: Full=ATP synthase subunit beta;          EC=3....   209   3e-52
CP002739_1778(CP002739|pid:none) Thermoanaerobacterium xylanolyt...   209   3e-52
(B0BRX2) RecName: Full=ATP synthase subunit beta;          EC=3....   209   3e-52
AP012224_3686(AP012224|pid:none) Pseudogulbenkiania sp. NH8B DNA...   209   4e-52
FN545181_31(FN545181|pid:none) Arsenophonus nasoniae whole genom...   209   4e-52
DQ403105_1(DQ403105|pid:none) Oryctolagus cuniculus mitochondria...   209   4e-52
CP002433_3940(CP002433|pid:none) Pantoea sp. At-9b, complete gen...   209   4e-52
CP001820_1519(CP001820|pid:none) Veillonella parvula DSM 2008, c...   209   4e-52
(Q5HB71) RecName: Full=ATP synthase subunit beta;          EC=3....   209   4e-52
(A6VF32) RecName: Full=ATP synthase subunit beta;          EC=3....   209   4e-52
DQ403116_1(DQ403116|pid:none) Balaenoptera physalus mitochondria...   209   4e-52
(A5G9D8) RecName: Full=ATP synthase subunit beta;          EC=3....   208   5e-52
(Q9JXQ2) RecName: Full=ATP synthase subunit beta;          EC=3....   208   5e-52
AM889136_230(AM889136|pid:none) Neisseria meningitidis alpha14 c...   208   5e-52
CP002870_5211(CP002870|pid:none) Pseudomonas putida S16, complet...   208   5e-52
(A5WBA3) RecName: Full=ATP synthase subunit beta;          EC=3....   208   5e-52
FN995097_1835(FN995097|pid:none) Neisseria lactamica 020-06 comp...   208   5e-52
D64071(D64071)H+-transporting two-sector ATPase (EC 3.6.3.14) be...   208   7e-52
(Q8RC15) RecName: Full=ATP synthase subunit beta;          EC=3....   208   7e-52
CP002206_3178(CP002206|pid:none) Pantoea vagans C9-1, complete g...   208   7e-52
CP002032_655(CP002032|pid:none) Thermoanaerobacter mathranii sub...   208   7e-52
(B1KQ34) RecName: Full=ATP synthase subunit beta;          EC=3....   208   7e-52
CP002607_4005(CP002607|pid:none) Aeromonas veronii B565, complet...   208   7e-52
(A3DIM9) RecName: Full=ATP synthase subunit beta;          EC=3....   208   7e-52
(A3N2U4) RecName: Full=ATP synthase subunit beta;          EC=3....   208   7e-52
CP002048_2215(CP002048|pid:none) Syntrophothermus lipocalidus DS...   208   7e-52
(P43715) RecName: Full=ATP synthase subunit beta;          EC=3....   208   7e-52
(B3PIS7) RecName: Full=ATP synthase subunit beta;          EC=3....   208   7e-52
(A9KBF7) RecName: Full=ATP synthase subunit beta;          EC=3....   207   9e-52
CP000554_498(CP000554|pid:none) Prochlorococcus marinus str. MIT...   207   9e-52
(Q2S6P1) RecName: Full=ATP synthase subunit beta;          EC=3....   207   9e-52
FP929038_633(FP929038|pid:none) Coprococcus catus GD/7 draft gen...   207   9e-52
AP012048_2072(AP012048|pid:none) Arcobacter sp. L DNA, complete ...   207   9e-52
(Q03235) RecName: Full=ATP synthase subunit beta;          EC=3....   207   9e-52
(A6LJR1) RecName: Full=ATP synthase subunit beta;          EC=3....   207   9e-52
CP002371_65(CP002371|pid:none) Candidatus Liberibacter solanacea...   207   9e-52
FN392235_3975(FN392235|pid:none) Erwinia pyrifoliae DSM 12163 co...   207   9e-52
(Q3SF66) RecName: Full=ATP synthase subunit beta;          EC=3....   207   9e-52
AE016828_1691(AE016828|pid:none) Coxiella burnetii RSA 493, comp...   207   9e-52
(A2C6Z4) RecName: Full=ATP synthase subunit beta;          EC=3....   207   9e-52
FN869568_3445(FN869568|pid:none) Halomonas elongata DSM 2581, co...   207   9e-52
CP002124_1165(CP002124|pid:none) Erwinia sp. Ejp617, complete ge...   207   9e-52
(Q10Z38) RecName: Full=ATP synthase subunit beta;          EC=3....   207   9e-52
GQ330988_1(GQ330988|pid:none) Haliclona (Haliclona) sp. KJP-2009...   207   1e-51
(A7G9Q9) RecName: Full=ATP synthase subunit beta;          EC=3....   207   1e-51
(B0TWS7) RecName: Full=ATP synthase subunit beta;          EC=3....   207   1e-51
AP011177_4335(AP011177|pid:none) Shewanella violacea DSS12 DNA, ...   207   1e-51
CP001132_2731(CP001132|pid:none) Acidithiobacillus ferrooxidans ...   207   1e-51
(P41168) RecName: Full=ATP synthase subunit beta;          EC=3....   207   1e-51
(A5III3) RecName: Full=ATP synthase subunit beta;          EC=3....   207   1e-51
CP002109_3864(CP002109|pid:none) Clostridium saccharolyticum WM1...   207   1e-51
DQ403111_1(DQ403111|pid:none) Felis catus mitochondrial ATP synt...   207   1e-51
CP002351_276(CP002351|pid:none) Thermotoga thermarum DSM 5069, c...   207   1e-51
(P55988) RecName: Full=ATP synthase subunit beta;          EC=3....   207   2e-51
CP001859_1656(CP001859|pid:none) Acidaminococcus fermentans DSM ...   207   2e-51
FR872580_2355(FR872580|pid:none) Parachlamydia acanthamoebae UV7...   207   2e-51
CP001685_618(CP001685|pid:none) Leptotrichia buccalis DSM 1135, ...   207   2e-51
CP002432_2210(CP002432|pid:none) Desulfurispirillum indicum S5, ...   207   2e-51
AK362825_1(AK362825|pid:none) Hordeum vulgare subsp. vulgare mRN...   207   2e-51
(A8EV70) RecName: Full=ATP synthase subunit beta;          EC=3....   207   2e-51
AK365943_1(AK365943|pid:none) Hordeum vulgare subsp. vulgare mRN...   207   2e-51
(C4LDW0) RecName: Full=ATP synthase subunit beta;          EC=3....   207   2e-51
(Q6FYM3) RecName: Full=ATP synthase subunit beta;          EC=3....   207   2e-51
GN102175_1(GN102175|pid:none) Sequence 6956 from Patent WO200903...   207   2e-51
FP236843_4587(FP236843|pid:none) Erwinia billingiae strain Eb661...   207   2e-51
(A3QJR0) RecName: Full=ATP synthase subunit beta;          EC=3....   207   2e-51
AB206839_8(AB206839|pid:none) Acidithiobacillus ferrooxidans atp...   207   2e-51
CP002336_1047(CP002336|pid:none) Helicobacter pylori SouthAfrica...   206   2e-51
(A0Q8D9) RecName: Full=ATP synthase subunit beta;          EC=3....   206   2e-51
CP001157_5023(CP001157|pid:none) Azotobacter vinelandii DJ, comp...   206   2e-51
(B5Z8D0) RecName: Full=ATP synthase subunit beta;          EC=3....   206   2e-51
FM991728_1057(FM991728|pid:none) Helicobacter pylori B38 complet...   206   2e-51
CP002074_1048(CP002074|pid:none) Helicobacter pylori PeCan4, com...   206   2e-51
K00560_1(K00560|pid:none) yeast (s.cerevisiae) mitochondrial atp...   206   2e-51
(A6W3S8) RecName: Full=ATP synthase subunit beta 2;          EC=...   206   2e-51
(A7HJV7) RecName: Full=ATP synthase subunit beta;          EC=3....   206   2e-51
CP002547_3153(CP002547|pid:none) Syntrophobotulus glycolicus DSM...   206   2e-51
(A4J999) RecName: Full=ATP synthase subunit beta;          EC=3....   206   2e-51
(Q9ZK81) RecName: Full=ATP synthase subunit beta;          EC=3....   206   2e-51
(B2VCA4) RecName: Full=ATP synthase subunit beta;          EC=3....   206   2e-51
FN598874_369(FN598874|pid:none) Helicobacter pylori B8 complete ...   206   2e-51
(C5BKJ5) RecName: Full=ATP synthase subunit beta;          EC=3....   206   2e-51
(B7IG44) RecName: Full=ATP synthase subunit beta;          EC=3....   206   3e-51
(Q9JW70) RecName: Full=ATP synthase subunit beta;          EC=3....   206   3e-51
CP001769_5023(CP001769|pid:none) Spirosoma linguale DSM 74, comp...   206   3e-51
CR940347_800(CR940347|pid:none) Theileria annulata strain Ankara...   206   3e-51
GQ330997_1(GQ330997|pid:none) Suberites sp. KJP-2009 ATP synthas...   206   3e-51
(B1KSS8) RecName: Full=ATP synthase subunit beta;          EC=3....   206   3e-51
(A8ZUA1) RecName: Full=ATP synthase subunit beta;          EC=3....   206   3e-51
(C1FQP5) RecName: Full=ATP synthase subunit beta;          EC=3....   206   3e-51
(A6QB59) RecName: Full=ATP synthase subunit beta;          EC=3....   206   3e-51
(P26527) RecName: Full=ATP synthase subunit beta;          EC=3....   206   3e-51
HM007290_1(HM007290|pid:none) Rhizoplaca chrysoleuca clone R20 A...   206   3e-51
(Q17Y78) RecName: Full=ATP synthase subunit beta;          EC=3....   206   3e-51
CP002606_977(CP002606|pid:none) Hippea maritima DSM 10411, compl...   206   3e-51
(B2UZK0) RecName: Full=ATP synthase subunit beta;          EC=3....   206   3e-51
(Q7U8U7) RecName: Full=ATP synthase subunit beta;          EC=3....   206   3e-51
(A8F3K2) RecName: Full=ATP synthase subunit beta;          EC=3....   206   3e-51
(B9L7Y7) RecName: Full=ATP synthase subunit beta;          EC=3....   206   3e-51
(A6TK65) RecName: Full=ATP synthase subunit beta;          EC=3....   206   3e-51
(B2TK00) RecName: Full=ATP synthase subunit beta;          EC=3....   206   3e-51
GN102169_1(GN102169|pid:none) Sequence 6950 from Patent WO200903...   206   3e-51
EU074273_1(EU074273|pid:none) Terebratulina retusa mitochondrial...   205   4e-51
(P29707) RecName: Full=ATP synthase subunit beta, sodium ion spe...   205   4e-51
CP001275_1178(CP001275|pid:none) Thermomicrobium roseum DSM 5159...   205   4e-51
FR695877_403(FR695877|pid:none) Uncultured Desulfobacterium sp. ...   205   4e-51
AY774529_1(AY774529|pid:none) Synthetic construct Francisella tu...   205   4e-51
CP002582_3540(CP002582|pid:none) Clostridium lentocellum DSM 542...   205   4e-51
CP002736_2542(CP002736|pid:none) Desulfotomaculum carboxydivoran...   205   4e-51
GQ330913_1(GQ330913|pid:none) Dysidea sp. KJP-2009 ATP synthase ...   205   6e-51
AY580175_1(AY580175|pid:none) Asterina miniata ATP synthase beta...   205   6e-51
AP011112_176(AP011112|pid:none) Hydrogenobacter thermophilus TK-...   205   6e-51
CP002552_335(CP002552|pid:none) Nitrosomonas sp. AL212, complete...   205   6e-51
FO082060_331(FO082060|pid:none) Methylomicrobium alcaliphilum st...   205   6e-51
(Q2YCA3) RecName: Full=ATP synthase subunit beta 1;          EC=...   205   6e-51
CP003029_68(CP003029|pid:none) Rhodothermus marinus SG0.5JP17-17...   204   8e-51
AP009049_3253(AP009049|pid:none) Clostridium kluyveri NBRC 12016...   204   8e-51
(O67828) RecName: Full=ATP synthase subunit beta;          EC=3....   204   8e-51
CP002332_1094(CP002332|pid:none) Helicobacter pylori Gambia94/24...   204   8e-51
(A5GNB1) RecName: Full=ATP synthase subunit beta;          EC=3....   204   8e-51
(Q32RY8) RecName: Full=ATP synthase subunit beta, chloroplastic;...   204   8e-51
GN102165_1(GN102165|pid:none) Sequence 6946 from Patent WO200903...   204   8e-51
CP001807_73(CP001807|pid:none) Rhodothermus marinus DSM 4252, co...   204   8e-51
(Q3AHM2) RecName: Full=ATP synthase subunit beta;          EC=3....   204   8e-51
CP002573_33(CP002573|pid:none) Acidithiobacillus caldus SM-1, co...   204   8e-51
(A5N3H7) RecName: Full=ATP synthase subunit beta;          EC=3....   204   8e-51
CP002205_776(CP002205|pid:none) Sulfurimonas autotrophica DSM 16...   204   8e-51
(Q48AW0) RecName: Full=ATP synthase subunit beta;          EC=3....   204   8e-51
AP011941_256(AP011941|pid:none) Helicobacter pylori F30 DNA, com...   204   1e-50
CP002331_1064(CP002331|pid:none) Helicobacter pylori India7, com...   204   1e-50
AP011943_1067(AP011943|pid:none) Helicobacter pylori F32 DNA, co...   204   1e-50
(Q03EL4) RecName: Full=ATP synthase subunit beta;          EC=3....   204   1e-50
(A9BFX3) RecName: Full=ATP synthase subunit beta;          EC=3....   204   1e-50
CP002983_1066(CP002983|pid:none) Helicobacter pylori SNT49, comp...   204   1e-50
(A3PES6) RecName: Full=ATP synthase subunit beta;          EC=3....   204   1e-50
CP002076_1103(CP002076|pid:none) Helicobacter pylori Cuz20, comp...   204   1e-50
CP001582_1087(CP001582|pid:none) Helicobacter pylori v225d, comp...   204   1e-50
CP002209_3765(CP002209|pid:none) Ferrimonas balearica DSM 9799, ...   204   1e-50
CP002982_1108(CP002982|pid:none) Helicobacter pylori Puno135, co...   204   1e-50
(O50292) RecName: Full=ATP synthase subunit beta;          EC=3....   204   1e-50
CP002980_1038(CP002980|pid:none) Helicobacter pylori Puno120, co...   204   1e-50
(A4VS62) RecName: Full=ATP synthase subunit beta;          EC=3....   204   1e-50
(A9AVV4) RecName: Full=ATP synthase subunit beta;          EC=3....   204   1e-50
CP001072_1103(CP001072|pid:none) Helicobacter pylori Shi470, com...   204   1e-50
CP002073_1076(CP002073|pid:none) Helicobacter pylori SJM180, com...   204   1e-50
DQ087459_1(DQ087459|pid:none) Sycon lingua ATP synthase beta sub...   204   1e-50
(C1F3N6) RecName: Full=ATP synthase subunit beta;          EC=3....   204   1e-50
AE013598_719(AE013598|pid:none) Xanthomonas oryzae pv. oryzae KA...   204   1e-50
FJ827069_1(FJ827069|pid:none) Gallibacterium anatis strain Yu-ZZ...   204   1e-50
(B2SQB0) RecName: Full=ATP synthase subunit beta;          EC=3....   204   1e-50
CP002159_2880(CP002159|pid:none) Gallionella capsiferriformans E...   204   1e-50
CP003057_3733(CP003057|pid:none) Xanthomonas oryzae pv. oryzicol...   204   1e-50
CP002056_2746(CP002056|pid:none) Methylotenera versatilis 301, c...   204   1e-50
CP000815_200(CP000815|pid:none) Paulinella chromatophora chromat...   204   1e-50
(Q8PGG7) RecName: Full=ATP synthase subunit beta;          EC=3....   204   1e-50
(Q1GXN0) RecName: Full=ATP synthase subunit beta;          EC=3....   204   1e-50
FP929140_3794(FP929140|pid:none) gamma proteobacterium HdN1, com...   204   1e-50
DQ087473_1(DQ087473|pid:none) Microciona prolifera ATP synthase ...   204   1e-50
CP001931_1284(CP001931|pid:none) Thermocrinis albus DSM 14484, c...   203   2e-50
FJ707530_1(FJ707530|pid:none) Dissiliaria muelleri ATP synthase ...   203   2e-50
CP001674_2803(CP001674|pid:none) Methylovorus glucosetrophus SIP...   203   2e-50
(Q318V4) RecName: Full=ATP synthase subunit beta;          EC=3....   203   2e-50
CP003093_2736(CP003093|pid:none) Pseudoxanthomonas spadix BD-a59...   203   2e-50
FP929052_640(FP929052|pid:none) Ruminococcus sp. 18P13 draft gen...   203   2e-50
CP002738_4387(CP002738|pid:none) Methylomonas methanica MC09, co...   203   2e-50
(Q7VA76) RecName: Full=ATP synthase subunit beta;          EC=3....   203   2e-50
GQ464994_1(GQ464994|pid:none) Gallibacterium anatis strain Yu-ZM...   203   2e-50
FP929044_2114(FP929044|pid:none) Eubacterium siraeum 70/3 draft ...   203   2e-50
(Q11Y90) RecName: Full=ATP synthase subunit beta;          EC=3....   203   2e-50
(Q82XP8) RecName: Full=ATP synthase subunit beta;          EC=3....   203   2e-50
FP929061_1945(FP929061|pid:none) Clostridiales sp. SSC/2 draft g...   203   2e-50
AY580244_1(AY580244|pid:none) Metridium senile ATP synthase beta...   203   2e-50
CP001220_336(CP001220|pid:none) Comamonas testosteroni CNB-2, co...   202   3e-50
(Q21DK8) RecName: Full=ATP synthase subunit beta;          EC=3....   202   3e-50
CP001796_3058(CP001796|pid:none) Pseudoalteromonas sp. SM9913 ch...   202   3e-50
CP001055_1501(CP001055|pid:none) Elusimicrobium minutum Pei191, ...   202   3e-50
HM859881_1(HM859881|pid:none) Cinachyrella alloclada ATP synthas...   202   3e-50
DQ403095_1(DQ403095|pid:none) Didelphis virginiana mitochondrial...   202   3e-50
(Q0AJB0) RecName: Full=ATP synthase subunit beta 1;          EC=...   202   3e-50
(Q3IK50) RecName: Full=ATP synthase subunit beta;          EC=3....   202   3e-50
CP001104_1426(CP001104|pid:none) Eubacterium eligens ATCC 27750,...   202   4e-50
(Q0AUD3) RecName: Full=ATP synthase subunit beta;          EC=3....   202   4e-50
CP001978_3679(CP001978|pid:none) Marinobacter adhaerens HP15, co...   202   4e-50
(B8D6S7) RecName: Full=ATP synthase subunit beta;          EC=3....   202   4e-50
AY296243_1(AY296243|pid:none) Actinobacillus rossii ATP synthase...   202   4e-50
CP001034_2792(CP001034|pid:none) Natranaerobius thermophilus JW/...   202   4e-50
FP929049_2876(FP929049|pid:none) Roseburia intestinalis M50/1 dr...   202   4e-50
(Q07232) RecName: Full=ATP synthase subunit beta;          EC=3....   202   5e-50
(B0U598) RecName: Full=ATP synthase subunit beta;          EC=3....   202   5e-50
DQ859784_1(DQ859784|pid:none) Ewingella americana strain ICMP 15...   202   5e-50
FR799578_120(FR799578|pid:none) Leishmania mexicana MHOM/GT/2001...   202   5e-50
CP001720_3868(CP001720|pid:none) Desulfotomaculum acetoxidans DS...   202   5e-50
(Q9PE85) RecName: Full=ATP synthase subunit beta;          EC=3....   202   5e-50
AM502243_123(AM502243|pid:none) Leishmania infantum chromosome 2...   202   5e-50
CP002599_90(CP002599|pid:none) Burkholderia gladioli BSR3 chromo...   202   5e-50
CP000012_1003(CP000012|pid:none) Helicobacter pylori 51, complet...   202   5e-50

>BT127859_1(BT127859|pid:none) Dendroctonus ponderosae clone
            DPO123_G12 unknown mRNA.
          Length = 515

 Score =  233 bits (594), Expect = 2e-59
 Identities = 119/159 (74%), Positives = 132/159 (83%)
 Frame = +3

Query: 639  DPAPATTFAHLDATTVLSRAISELGIYPCVDPLDSTSLMMDPNIIGVEHYKVATDVQKIL 818
            DPAPATTFAHLDATTVLSRAI+ELGIYP VDPLDSTS +MDPNIIG EHY +A  VQKIL
Sbjct: 357  DPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIIGQEHYNIARGVQKIL 416

Query: 819  QEYKSLQDIIAILGMDDLSEDQKATVFRARKIQRFLSQPFEVAHAFTNMEGRFVKLSDSI 998
            Q+YKSLQDIIAILGMD+LSED K TV RARKIQRFLSQPF+VA  FT   G+ V L ++I
Sbjct: 417  QDYKSLQDIIAILGMDELSEDDKLTVARARKIQRFLSQPFQVAEVFTGHPGKLVPLEETI 476

Query: 999  KAFKGILEGKYDHLPEAAFYMVGGIEDVEIKAAKLLESA 1115
            K F+ IL G YDHLPE AFYMVG IE+V  KA KL E++
Sbjct: 477  KGFQKILGGDYDHLPEVAFYMVGPIEEVVQKAEKLAETS 515

 Score = 75.9 bits (185), Expect = 5e-12
 Identities = 57/146 (39%), Positives = 76/146 (52%)
 Frame = +2

Query: 188 YFEKNKSLLDKESNEESTEVDYSKLNENQGVVHQVIGAVVDVYFPHGKLPYINDALIVDD 367
           +F++N++L  K +  ++           +G +  VIGAVVDV F    LP I +AL V
Sbjct: 31  HFQQNRTLAAKAAAGQA-----------KGRIVAVIGAVVDVQF-EDDLPPILNALEVA- 77

Query: 368 FQAENVEKVIEDLNNPSLKGKIDFNNVPISNIKLVLEVAQHLGDGIVRCVALDITDGLXR 547
                                   N  P    +LVLEVAQHLG+  VR +A+D T+GL R
Sbjct: 78  ------------------------NRSP----RLVLEVAQHLGENTVRTIAMDGTEGLVR 109

Query: 548 GALVLNTGSPLMVPVGQATLGRIMNV 625
           G  VL+TG P+ +PVG  TLGRIMNV
Sbjct: 110 GQNVLDTGYPIRIPVGVETLGRIMNV 135

Lambda     K      H
   0.318    0.134    0.401

Gapped
Lambda     K      H
   0.267   0.0410    0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 5349213
Number of Hits to DB: 3,415,944,539
Number of extensions: 67648221
Number of successful extensions: 207992
Number of sequences better than 10.0: 5330
Number of HSP's gapped: 205375
Number of HSP's successfully gapped: 9089
Length of query: 461
Length of database: 1,732,582,204
Length adjustment: 135
Effective length of query: 326
Effective length of database: 1,010,438,449
Effective search space: 329402934374
Effective search space used: 329402934374
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)




Dictyostelium discoideum cDNA Project Home