Homology VHC289 vs Protein

Query= VHC289 (VHC289Q) /CSM/VH/VHC2-D/VHC289Q.Seq.d/
         (1418 letters)

Database: nrp_B
           5,349,213 sequences; 1,732,582,204 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT127859_1(BT127859|pid:none) Dendroctonus ponderosae clone DPO1...   218   5e-55
(P72247) RecName: Full=ATP synthase subunit beta;          EC=3....   218   9e-55
AK159737_1(AK159737|pid:none) Mus musculus osteoclast-like cell ...   218   9e-55
GN102155_1(GN102155|pid:none) Sequence 6936 from Patent WO200903...   217   2e-54
(Q5ZLC5) RecName: Full=ATP synthase subunit beta, mitochondrial;...   217   2e-54
(Q162S9) RecName: Full=ATP synthase subunit beta;          EC=3....   217   2e-54
(P38482) RecName: Full=ATP synthase subunit beta, mitochondrial;...   217   2e-54
BC067388_1(BC067388|pid:none) Xenopus tropicalis ATP synthase, H...   216   2e-54
AK151081_1(AK151081|pid:none) Mus musculus bone marrow macrophag...   216   3e-54
BC037127_1(BC037127|pid:none) Mus musculus ATP synthase, H+ tran...   216   3e-54
AK166603_1(AK166603|pid:none) Mus musculus 4 days embryo whole b...   216   3e-54
(Q3U774) RecName: Full=ATP synthase subunit beta, mitochondrial;...   216   3e-54
(P10719) RecName: Full=ATP synthase subunit beta, mitochondrial;...   216   3e-54
(Q3YS09) RecName: Full=ATP synthase subunit beta;          EC=3....   216   3e-54
A28701(A28701;S70510)H+-transporting two-sector ATPase (EC 3.6.3...   216   3e-54
DQ443322_1(DQ443322|pid:none) Bombyx mori H+ transporting ATP sy...   216   3e-54
DQ443321_1(DQ443321|pid:none) Bombyx mori H+ transporting ATP sy...   216   3e-54
AK167764_1(AK167764|pid:none) Mus musculus TIB-55 BB88 cDNA, RIK...   215   4e-54
HM156739_1(HM156739|pid:none) Helicoverpa zea ATP synthase mRNA,...   215   4e-54
(Q9PTY0) RecName: Full=ATP synthase subunit beta, mitochondrial;...   215   4e-54
D00022_1(D00022|pid:none) Homo sapiens mRNA for F1 beta subunit,...   215   6e-54
FJ208948_1(FJ208948|pid:none) Gillichthys mirabilis F1 ATP synth...   215   6e-54
BT120312_1(BT120312|pid:none) Drosophila melanogaster RE21838 fu...   215   6e-54
X05606_1(X05606|pid:none) Human mRNA fragment for ATP synthetase...   215   6e-54
(P06576) RecName: Full=ATP synthase subunit beta, mitochondrial;...   215   6e-54
FP929003_363(FP929003|pid:none) Candidatus Nitrospira defluvii c...   215   6e-54
(Q05825) RecName: Full=ATP synthase subunit beta, mitochondrial;...   215   6e-54
X05605_1(X05605|pid:none) Bovine mRNA fragment for ATP synthetas...   214   7e-54
(P00829) RecName: Full=ATP synthase subunit beta, mitochondrial;...   214   7e-54
BC124410_1(BC124410|pid:none) Danio rerio zgc:163069, mRNA (cDNA...   214   7e-54
AB104883_1(AB104883|pid:none) Zygosaccharomyces rouxii ZrATP2 ge...   214   7e-54
FN392320_1159(FN392320|pid:none) Pichia pastoris GS115 chromosom...   214   7e-54
(P49376) RecName: Full=ATP synthase subunit beta, mitochondrial;...   214   7e-54
BC046741_1(BC046741|pid:none) Xenopus laevis ATP synthase, H+ tr...   214   7e-54
EZ424166_1(EZ424166|pid:none) TSA: Glossina morsitans morsitans ...   214   1e-53
CP002347_1578(CP002347|pid:none) Calditerrivibrio nitroreducens ...   214   1e-53
CP002897_1144(CP002897|pid:none) Paracoccus denitrificans SD1, c...   214   1e-53
AB603754_1(AB603754|pid:none) Mesocricetus auratus atp5b mRNA fo...   214   1e-53
DQ440233_1(DQ440233|pid:none) Aedes aegypti clone AET-272 F0F1-t...   213   2e-53
CP002503_187(CP002503|pid:none) Eremothecium cymbalariae DBVPG#7...   213   2e-53
GN102063_1(GN102063|pid:none) Sequence 6844 from Patent WO200903...   213   2e-53
AY312637_1(AY312637|pid:none) Drosophila simulans strain DsimSey...   213   2e-53
GN102557_1(GN102557|pid:none) Sequence 7338 from Patent WO200903...   213   2e-53
(Q11DD5) RecName: Full=ATP synthase subunit beta;          EC=3....   213   2e-53
CP000498_39(CP000498|pid:none) Scheffersomyces stipitis CBS 6054...   213   3e-53
CP002018_455(CP002018|pid:none) Ketogulonigenium vulgarum WSH-00...   212   4e-53
AF030559_1(AF030559|pid:none) Mus musculus ATP synthase beta-sub...   212   4e-53
CP000613_2186(CP000613|pid:none) Rhodospirillum centenum SW, com...   212   5e-53
AJ870436_1(AJ870436|pid:none) Polytomella sp. Pringsheim 198.80 ...   212   5e-53
AP010803_2685(AP010803|pid:none) Sphingobium japonicum UT26S DNA...   211   6e-53
(B6JD09) RecName: Full=ATP synthase subunit beta;          EC=3....   211   6e-53
CU928176_67(CU928176|pid:none) Zygosaccharomyces rouxii strain C...   211   6e-53
(A9H9A8) RecName: Full=ATP synthase subunit beta;          EC=3....   211   6e-53
(Q01859) RecName: Full=ATP synthase subunit beta, mitochondrial;...   211   8e-53
EF148198_1(EF148198|pid:none) Populus trichocarpa clone WS0128_K...   211   8e-53
CP002083_3369(CP002083|pid:none) Hyphomicrobium denitrificans AT...   211   8e-53
CP001016_215(CP001016|pid:none) Beijerinckia indica subsp. indic...   211   8e-53
(A8LJR4) RecName: Full=ATP synthase subunit beta 2;          EC=...   211   1e-52
(Q1RKD7) RecName: Full=ATP synthase subunit beta;          EC=3....   211   1e-52
AP012206_402(AP012206|pid:none) Bradyrhizobium japonicum USDA 6 ...   211   1e-52
CP002029_93(CP002029|pid:none) Campylobacter jejuni subsp. jejun...   211   1e-52
(A1VXJ0) RecName: Full=ATP synthase subunit beta;          EC=3....   211   1e-52
AJ843974_1(AJ843974|pid:none) Plantago major partial mRNA for mi...   210   1e-52
AP008207_2168(AP008207|pid:none) Oryza sativa (japonica cultivar...   210   1e-52
GN102563_1(GN102563|pid:none) Sequence 7344 from Patent WO200903...   210   1e-52
GN102555_1(GN102555|pid:none) Sequence 7336 from Patent WO200903...   210   1e-52
GN102561_1(GN102561|pid:none) Sequence 7342 from Patent WO200903...   210   1e-52
(A7ZC37) RecName: Full=ATP synthase subunit beta;          EC=3....   210   1e-52
EF085070_1(EF085070|pid:none) Picea sitchensis clone WS02728_O12...   210   2e-52
(P43395) RecName: Full=ATP synthase subunit beta, mitochondrial;...   210   2e-52
(B0THN2) RecName: Full=ATP synthase subunit beta;          EC=3....   210   2e-52
EU401720_1(EU401720|pid:none) Litopenaeus vannamei F1-ATP syntha...   210   2e-52
GN102565_1(GN102565|pid:none) Sequence 7346 from Patent WO200903...   209   2e-52
GN102059_1(GN102059|pid:none) Sequence 6840 from Patent WO200903...   209   2e-52
M19483_1(M19483|pid:none) Human ATP synthase beta subunit gene, ...   209   2e-52
(Q68VU8) RecName: Full=ATP synthase subunit beta;          EC=3....   209   2e-52
DQ358698_1(DQ358698|pid:none) Pinctada fucata ATP synthase beta ...   209   2e-52
CR382128_148(CR382128|pid:none) Yarrowia lipolytica strain CLIB1...   209   2e-52
(C0R5I6) RecName: Full=ATP synthase subunit beta;          EC=3....   209   3e-52
(A4WUM7) RecName: Full=ATP synthase subunit beta;          EC=3....   209   3e-52
(A4YKE0) RecName: Full=ATP synthase subunit beta;          EC=3....   209   4e-52
FN319667_1(FN319667|pid:none) Schistosoma japonicum isolate Anhu...   209   4e-52
GN102123_1(GN102123|pid:none) Sequence 6904 from Patent WO200903...   209   4e-52
(P46561) RecName: Full=ATP synthase subunit beta, mitochondrial;...   209   4e-52
CP002355_757(CP002355|pid:none) Sulfuricurvum kujiense DSM 16994...   209   4e-52
FJ605485_1(FJ605485|pid:none) Procambarus clarkii F1F0-ATP synth...   209   4e-52
(Q2VZN2) RecName: Full=ATP synthase subunit beta;          EC=3....   209   4e-52
CP000683_877(CP000683|pid:none) Rickettsia massiliae MTU5, compl...   209   4e-52
AK364060_1(AK364060|pid:none) Hordeum vulgare subsp. vulgare mRN...   209   4e-52
FN319664_1(FN319664|pid:none) Schistosoma japonicum isolate Anhu...   209   4e-52
(Q2G5N5) RecName: Full=ATP synthase subunit beta;          EC=3....   209   4e-52
(A5E950) RecName: Full=ATP synthase subunit beta 1;          EC=...   209   4e-52
CP001751_1844(CP001751|pid:none) Candidatus Puniceispirillum mar...   208   5e-52
FJ042670_1(FJ042670|pid:none) Fenneropenaeus chinensis F1F0-ATP ...   208   5e-52
AP012159_1411(AP012159|pid:none) Gluconacetobacter xylinus NBRC ...   208   5e-52
D10491_1(D10491|pid:none) Oryza sativa Japonica Group atpB gene ...   208   5e-52
(A8GY40) RecName: Full=ATP synthase subunit beta;          EC=3....   208   5e-52
CP003075_3118(CP003075|pid:none) Pelagibacterium halotolerans B2...   208   5e-52
AP011121_117(AP011121|pid:none) Acetobacter pasteurianus IFO 328...   208   7e-52
(A8GPZ4) RecName: Full=ATP synthase subunit beta;          EC=3....   208   7e-52
(Q89X74) RecName: Full=ATP synthase subunit beta;          EC=3....   208   7e-52
CP002279_1197(CP002279|pid:none) Mesorhizobium opportunistum WSM...   208   7e-52
AE017346_61(AE017346|pid:none) Cryptococcus neoformans var. neof...   208   7e-52
(A8F004) RecName: Full=ATP synthase subunit beta;          EC=3....   207   9e-52
(A5VSE1) RecName: Full=ATP synthase subunit beta;          EC=3....   207   9e-52
(A3PIB9) RecName: Full=ATP synthase subunit beta 1;          EC=...   207   9e-52
CP002447_1168(CP002447|pid:none) Mesorhizobium ciceri biovar bis...   207   1e-51
CP001280_337(CP001280|pid:none) Methylocella silvestris BL2, com...   207   1e-51
(Q73IG3) RecName: Full=ATP synthase subunit beta;          EC=3....   207   1e-51
CP001349_7065(CP001349|pid:none) Methylobacterium nodulans ORS 2...   207   1e-51
(Q2YLE6) RecName: Full=ATP synthase subunit beta;          EC=3....   207   1e-51
GN102197_1(GN102197|pid:none) Sequence 6978 from Patent WO200903...   207   2e-51
(P17614) RecName: Full=ATP synthase subunit beta, mitochondrial;...   207   2e-51
GN102239_1(GN102239|pid:none) Sequence 7020 from Patent WO200903...   207   2e-51
(B3CN17) RecName: Full=ATP synthase subunit beta;          EC=3....   207   2e-51
(P83483) RecName: Full=ATP synthase subunit beta-1, mitochondria...   206   2e-51
(O50290) RecName: Full=ATP synthase subunit beta;          EC=3....   206   2e-51
(A7HIX7) RecName: Full=ATP synthase subunit beta;          EC=3....   206   2e-51
BT000796_1(BT000796|pid:none) Arabidopsis thaliana unknown prote...   206   2e-51
CP001584_852(CP001584|pid:none) Rickettsia prowazekii Rp22, comp...   206   2e-51
CP002688_1055(CP002688|pid:none) Arabidopsis thaliana chromosome...   206   2e-51
AK359072_1(AK359072|pid:none) Hordeum vulgare subsp. vulgare mRN...   206   2e-51
AJ271468_1(AJ271468|pid:none) Arabidopsis thaliana mRNA for mito...   206   2e-51
AK229974_1(AK229974|pid:none) Arabidopsis thaliana mRNA for H+-t...   206   2e-51
(P83484) RecName: Full=ATP synthase subunit beta-2, mitochondria...   206   2e-51
AP011529_1840(AP011529|pid:none) Deferribacter desulfuricans SSM...   206   2e-51
(B0T335) RecName: Full=ATP synthase subunit beta;          EC=3....   206   3e-51
CP002131_1943(CP002131|pid:none) Thermosediminibacter oceani DSM...   206   3e-51
(Q13DP2) RecName: Full=ATP synthase subunit beta;          EC=3....   206   3e-51
GQ922833_1(GQ922833|pid:none) Pseudozyma flocculosa ATP synthase...   206   3e-51
GN102065_1(GN102065|pid:none) Sequence 6846 from Patent WO200903...   206   3e-51
(Q0BQE8) RecName: Full=ATP synthase subunit beta;          EC=3....   206   3e-51
GN102205_1(GN102205|pid:none) Sequence 6986 from Patent WO200903...   206   3e-51
(Q5PAN2) RecName: Full=ATP synthase subunit beta;          EC=3....   206   3e-51
CP001079_454(CP001079|pid:none) Anaplasma marginale str. Florida...   206   3e-51
(B0SDA5) RecName: Full=ATP synthase subunit beta;          EC=3....   206   3e-51
(P42469) RecName: Full=ATP synthase subunit beta;          EC=3....   205   5e-51
(Q3SVJ1) RecName: Full=ATP synthase subunit beta;          EC=3....   205   5e-51
M12082_1(M12082|pid:none) Yeast (S.cerevisiae) nuclear ATP2 gene...   205   6e-51
CP002271_938(CP002271|pid:none) Stigmatella aurantiaca DW4/3-1, ...   205   6e-51
(Q1MAZ2) RecName: Full=ATP synthase subunit beta;          EC=3....   205   6e-51
AE017321_685(AE017321|pid:none) Wolbachia endosymbiont strain TR...   205   6e-51
(P05038) RecName: Full=ATP synthase subunit beta;          EC=3....   205   6e-51
(A6WXX1) RecName: Full=ATP synthase subunit beta;          EC=3....   204   8e-51
(A1ALL7) RecName: Full=ATP synthase subunit beta 1;          EC=...   204   8e-51
AP012035_1725(AP012035|pid:none) Acidiphilium multivorum AIU301 ...   204   8e-51
DQ674545_1(DQ674545|pid:none) Coccidioides posadasii ATP synthas...   204   8e-51
(Q25117) RecName: Full=ATP synthase subunit beta, mitochondrial;...   204   1e-50
(B3EA01) RecName: Full=ATP synthase subunit beta;          EC=3....   204   1e-50
AP007175_411(AP007175|pid:none) Aspergillus oryzae RIB40 DNA, SC...   204   1e-50
AC144731_35(AC144731|pid:none) Medicago truncatula clone mth2-5g...   204   1e-50
CP001131_4443(CP001131|pid:none) Anaeromyxobacter sp. K, complet...   204   1e-50
(C3M9S1) RecName: Full=ATP synthase subunit beta;          EC=3....   203   2e-50
(C4K227) RecName: Full=ATP synthase subunit beta;          EC=3....   203   2e-50
AB266032_1(AB266032|pid:none) Dicyema acuticephalum gene for ATP...   203   2e-50
CP000633_3010(CP000633|pid:none) Agrobacterium vitis S4 chromoso...   203   2e-50
GN102129_1(GN102129|pid:none) Sequence 6910 from Patent WO200903...   203   2e-50
AE006914_1235(AE006914|pid:none) Rickettsia conorii str. Malish ...   203   2e-50
CP002912_1166(CP002912|pid:none) Rickettsia heilongjiangensis 05...   203   2e-50
(C3PLT1) RecName: Full=ATP synthase subunit beta;          EC=3....   203   2e-50
(A8GTS6) RecName: Full=ATP synthase subunit beta;          EC=3....   203   2e-50
CP000766_1244(CP000766|pid:none) Rickettsia rickettsii str. Iowa...   203   2e-50
CP001896_46(CP001896|pid:none) Allochromatium vinosum DSM 180, c...   203   2e-50
(A5CDA5) RecName: Full=ATP synthase subunit beta;          EC=3....   202   3e-50
FM162591_36(FM162591|pid:none) Photorhabdus asymbiotica ATCC4394...   202   3e-50
AK374834_1(AK374834|pid:none) Hordeum vulgare subsp. vulgare mRN...   202   3e-50
CP002085_285(CP002085|pid:none) Desulfarculus baarsii DSM 2075, ...   202   3e-50
CP000908_1438(CP000908|pid:none) Methylobacterium extorquens PA1...   202   3e-50
CP003008_543(CP003008|pid:none) Myceliophthora thermophila ATCC ...   202   3e-50
CP001622_3870(CP001622|pid:none) Rhizobium leguminosarum bv. tri...   202   3e-50
CP002780_3581(CP002780|pid:none) Desulfotomaculum ruminis DSM 21...   202   3e-50
CP002330_1226(CP002330|pid:none) Caldicellulosiruptor kronotskye...   202   3e-50
AP010946_2492(AP010946|pid:none) Azospirillum sp. B510 DNA, comp...   202   3e-50
CP003001_747(CP003001|pid:none) Caldicellulosiruptor lactoacetic...   202   3e-50
FP565575_2881(FP565575|pid:none) Candidatus Methylomirabilis oxy...   202   4e-50
CP000628_3248(CP000628|pid:none) Agrobacterium radiobacter K84 c...   202   4e-50
(Q1QQS8) RecName: Full=ATP synthase subunit beta;          EC=3....   202   4e-50
(B3CRK6) RecName: Full=ATP synthase subunit beta;          EC=3....   202   4e-50
GU292799_1(GU292799|pid:none) Miniopterus fuliginosus mitochondr...   202   4e-50
CP002304_379(CP002304|pid:none) Halanaerobium hydrogeniformans, ...   202   5e-50
(Q0AKW0) RecName: Full=ATP synthase subunit beta;          EC=3....   202   5e-50
CU638744_194(CU638744|pid:none) Podospora anserina S mat+ genomi...   202   5e-50
CP002511_489(CP002511|pid:none) Candidatus Pelagibacter sp. IMCC...   202   5e-50
(B3EJK9) RecName: Full=ATP synthase subunit beta;          EC=3....   202   5e-50
CP001968_856(CP001968|pid:none) Denitrovibrio acetiphilus DSM 12...   201   7e-50
(A1RQB0) RecName: Full=ATP synthase subunit beta;          EC=3....   201   7e-50
CP002829_1507(CP002829|pid:none) Thermodesulfobacterium sp. OPB4...   201   7e-50
(Q7NA94) RecName: Full=ATP synthase subunit beta;          EC=3....   201   7e-50
CP002480_1127(CP002480|pid:none) Granulicella sp. MP5ACTX9, comp...   201   7e-50
DQ403107_1(DQ403107|pid:none) Homo sapiens mitochondrial ATP syn...   201   9e-50
(Q5FRC5) RecName: Full=ATP synthase subunit beta 1;          EC=...   201   9e-50
FP565176_2845(FP565176|pid:none) Xanthomonas albilineans str. GP...   201   1e-49
(Q6CYJ5) RecName: Full=ATP synthase subunit beta;          EC=3....   201   1e-49
(A4Y187) RecName: Full=ATP synthase subunit beta;          EC=3....   201   1e-49
AB003549_1(AB003549|pid:none) Pisum sativum mRNA for F1 ATPase, ...   201   1e-49
(A7I177) RecName: Full=ATP synthase subunit beta;          EC=3....   201   1e-49
GN102053_1(GN102053|pid:none) Sequence 6834 from Patent WO200903...   201   1e-49
CP002727_4443(CP002727|pid:none) Pseudomonas fulva 12-X, complet...   200   1e-49
CP000096_21(CP000096|pid:none) Chlorobium luteolum DSM 273, comp...   200   1e-49
Y15178_1(Y15178|pid:none) Sorghum bicolor F1-ATP synthase, culti...   200   1e-49
(B3PQ68) RecName: Full=ATP synthase subunit beta;          EC=3....   200   1e-49
(C3K1E6) RecName: Full=ATP synthase subunit beta;          EC=3....   200   1e-49
CP001707_2613(CP001707|pid:none) Kangiella koreensis DSM 16069, ...   200   1e-49
(C6DJH2) RecName: Full=ATP synthase subunit beta;          EC=3....   200   1e-49
FP929064_427(FP929064|pid:none) Leptosphaeria maculans JN3 lm_Su...   200   1e-49
(Q1IIG8) RecName: Full=ATP synthase subunit beta;          EC=3....   200   2e-49
CP002585_6078(CP002585|pid:none) Pseudomonas brassicacearum subs...   200   2e-49
(Q65Q07) RecName: Full=ATP synthase subunit beta;          EC=3....   200   2e-49
(Q87TT4) RecName: Full=ATP synthase subunit beta;          EC=3....   200   2e-49
(Q8KAC9) RecName: Full=ATP synthase subunit beta 2;          EC=...   200   2e-49
CP002431_3072(CP002431|pid:none) Desulfovibrio aespoeensis Aspo-...   200   2e-49
(A3DAR4) RecName: Full=ATP synthase subunit beta;          EC=3....   200   2e-49
AM910996_536(AM910996|pid:none) Plasmodium knowlesi strain H chr...   200   2e-49
(Q04S18) RecName: Full=ATP synthase subunit beta;          EC=3....   200   2e-49
(Q48BG5) RecName: Full=ATP synthase subunit beta;          EC=3....   200   2e-49
CP001104_1871(CP001104|pid:none) Eubacterium eligens ATCC 27750,...   200   2e-49
AF025802_1(AF025802|pid:none) Drosophila subobscura ATP synthase...   199   2e-49
GN102397_1(GN102397|pid:none) Sequence 7178 from Patent WO200903...   199   2e-49
CP002246_3926(CP002246|pid:none) Yersinia enterocolitica subsp. ...   199   2e-49
AY897519_1(AY897519|pid:none) Wolbachia endosymbiont of Drosophi...   199   2e-49
AM270321_1(AM270321|pid:none) Aspergillus niger contig An14c0140...   199   2e-49
(Q72SX9) RecName: Full=ATP synthase subunit beta;          EC=3....   199   2e-49
CP001574_443(CP001574|pid:none) Micromonas sp. RCC299 chromosome...   199   2e-49
(A4TSJ3) RecName: Full=ATP synthase subunit beta;          EC=3....   199   2e-49
CP001593_3534(CP001593|pid:none) Yersinia pestis Z176003, comple...   199   2e-49
(B1I6J7) RecName: Full=ATP synthase subunit beta;          EC=3....   199   2e-49
(A8G1W5) RecName: Full=ATP synthase subunit beta;          EC=3....   199   3e-49
(A8HAG3) RecName: Full=ATP synthase subunit beta;          EC=3....   199   3e-49
GN102127_1(GN102127|pid:none) Sequence 6908 from Patent WO200903...   199   3e-49
CP002505_4369(CP002505|pid:none) Rahnella sp. Y9602, complete ge...   199   3e-49
(Q24MP1) RecName: Full=ATP synthase subunit beta;          EC=3....   199   3e-49
(Q07VU4) RecName: Full=ATP synthase subunit beta 1;          EC=...   199   3e-49
(Q2K3H0) RecName: Full=ATP synthase subunit beta;          EC=3....   199   3e-49
GN102167_1(GN102167|pid:none) Sequence 6948 from Patent WO200903...   199   3e-49
(B0UWG5) RecName: Full=ATP synthase subunit beta;          EC=3....   199   3e-49
CP001108_50(CP001108|pid:none) Prosthecochloris aestuarii DSM 27...   199   4e-49
(Q313W0) RecName: Full=ATP synthase subunit beta;          EC=3....   199   4e-49
(A1AHR4) RecName: Full=ATP synthase subunit beta;          EC=3....   199   4e-49
CP002890_4483(CP002890|pid:none) Escherichia coli UMNF18, comple...   199   4e-49
(Q329S1) RecName: Full=ATP synthase subunit beta;          EC=3....   199   4e-49
FR823389_184(FR823389|pid:none) Neospora caninum Liverpool compl...   199   4e-49
DQ228960_1(DQ228960|pid:none) Toxoplasma gondii mitochondrial F1...   199   4e-49
(A8A6J5) RecName: Full=ATP synthase subunit beta;          EC=3....   199   4e-49
(Q3K441) RecName: Full=ATP synthase subunit beta;          EC=3....   199   4e-49
(C6E9F1) RecName: Full=ATP synthase subunit beta;          EC=3....   199   4e-49
(B5EFI7) RecName: Full=ATP synthase subunit beta;          EC=3....   199   4e-49
(B4F0E7) RecName: Full=ATP synthase subunit beta;          EC=3....   199   4e-49
FN645454_1262(FN645454|pid:none) Bartonella clarridgeiae strain ...   198   6e-49
(A1VFJ5) RecName: Full=ATP synthase subunit beta;          EC=3....   198   6e-49
(A5WBW1) RecName: Full=ATP synthase subunit beta;          EC=3....   198   6e-49
(A1BCJ2) RecName: Full=ATP synthase subunit beta;          EC=3....   198   6e-49
FR824232_13(FR824232|pid:none) Albugo laibachii Nc14, genomic co...   198   6e-49
(B8FZ34) RecName: Full=ATP synthase subunit beta;          EC=3....   198   6e-49
AK003460_1(AK003460|pid:none) Mus musculus 18-day embryo whole b...   198   6e-49
(P42465) RecName: Full=ATP synthase subunit beta;          EC=3....   198   6e-49
(A0LLF8) RecName: Full=ATP synthase subunit beta;          EC=3....   198   6e-49
AF188265_8(AF188265|pid:none) Salmonella typhimurium strain TA98...   198   6e-49
(A7IH31) RecName: Full=ATP synthase subunit beta;          EC=3....   198   6e-49
(A1SBU0) RecName: Full=ATP synthase subunit beta;          EC=3....   198   6e-49
AM920436_1007(AM920436|pid:none) Penicillium chrysogenum Wiscons...   198   6e-49
FN645467_51(FN645467|pid:none) Bartonella rochalimae ATCC BAA-14...   198   7e-49
CP002005_382(CP002005|pid:none) Moraxella catarrhalis RH4, compl...   198   7e-49
FJ599948_1(FJ599948|pid:none) Pfiesteria piscicida clone Ppi+Rho...   198   7e-49
(A9IYW6) RecName: Full=ATP synthase subunit beta;          EC=3....   198   7e-49
CP002824_1418(CP002824|pid:none) Enterobacter aerogenes KCTC 219...   198   7e-49
(Q1CX36) RecName: Full=ATP synthase subunit beta;          EC=3....   198   7e-49
CP001918_5103(CP001918|pid:none) Enterobacter cloacae subsp. clo...   198   7e-49
(A6VL57) RecName: Full=ATP synthase subunit beta;          EC=3....   197   9e-49
AF283808_8(AF283808|pid:none) Clostridium pasteurianum atp opero...   197   9e-49
(B5RFW3) RecName: Full=ATP synthase subunit beta;          EC=3....   197   9e-49
(A8ACN6) RecName: Full=ATP synthase subunit beta;          EC=3....   197   9e-49
(Q1MRB8) RecName: Full=ATP synthase subunit beta;          EC=3....   197   9e-49
FN543093_10(FN543093|pid:none) Cronobacter turicensis z3032 comp...   197   9e-49
(A9MJR9) RecName: Full=ATP synthase subunit beta;          EC=3....   197   9e-49
(A7MMW9) RecName: Full=ATP synthase subunit beta;          EC=3....   197   9e-49
HQ199262_1(HQ199262|pid:none) Karlodinium micrum mitochondrial A...   197   1e-48
(B1JFU1) RecName: Full=ATP synthase subunit beta;          EC=3....   197   1e-48
CP001798_3734(CP001798|pid:none) Nitrosococcus halophilus Nc4, c...   197   1e-48
(B0KRA8) RecName: Full=ATP synthase subunit beta;          EC=3....   197   1e-48
(Q2RFX9) RecName: Full=ATP synthase subunit beta;          EC=3....   197   1e-48
FQ790286_270(FQ790286|pid:none) Botryotinia fuckeliana isolate T...   197   1e-48
FN543502_3933(FN543502|pid:none) Citrobacter rodentium ICC168, c...   197   1e-48
(B2FHY8) RecName: Full=ATP synthase subunit beta;          EC=3....   197   2e-48
(A5EXL4) RecName: Full=ATP synthase subunit beta;          EC=3....   197   2e-48
FN645485_151(FN645485|pid:none) Bartonella sp. AR 15-3 contig18,...   197   2e-48
CP003026_4387(CP003026|pid:none) Enterobacter asburiae LF7a, com...   197   2e-48
CP001277_2092(CP001277|pid:none) Candidatus Hamiltonella defensa...   197   2e-48
CP002986_3529(CP002986|pid:none) Stenotrophomonas maltophilia JV...   197   2e-48
(A4WGF5) RecName: Full=ATP synthase subunit beta;          EC=3....   197   2e-48
(Q4FQ37) RecName: Full=ATP synthase subunit beta;          EC=3....   197   2e-48
GN102159_1(GN102159|pid:none) Sequence 6940 from Patent WO200903...   196   2e-48
CP001785_82(CP001785|pid:none) Ammonifex degensii KC4, complete ...   196   2e-48
(O67828) RecName: Full=ATP synthase subunit beta;          EC=3....   196   2e-48
AP012048_2072(AP012048|pid:none) Arcobacter sp. L DNA, complete ...   196   2e-48
(Q03235) RecName: Full=ATP synthase subunit beta;          EC=3....   196   2e-48
GQ330912_1(GQ330912|pid:none) Darwinella muelleri ATP synthase b...   196   2e-48
(B4SAN6) RecName: Full=ATP synthase subunit beta;          EC=3....   196   2e-48
FJ555372_1(FJ555372|pid:none) Brachionus plicatilis ATP synthase...   196   2e-48
CP001654_3927(CP001654|pid:none) Dickeya dadantii Ech703, comple...   196   2e-48
HM007290_1(HM007290|pid:none) Rhizoplaca chrysoleuca clone R20 A...   196   3e-48
FR872580_2355(FR872580|pid:none) Parachlamydia acanthamoebae UV7...   196   3e-48
AP011112_176(AP011112|pid:none) Hydrogenobacter thermophilus TK-...   196   3e-48
(A1UR49) RecName: Full=ATP synthase subunit beta;          EC=3....   196   3e-48
CP001820_1519(CP001820|pid:none) Veillonella parvula DSM 2008, c...   196   3e-48
CP002364_2594(CP002364|pid:none) Desulfobulbus propionicus DSM 2...   196   3e-48
(O50292) RecName: Full=ATP synthase subunit beta;          EC=3....   196   3e-48
(Q0QEP2) RecName: Full=ATP synthase subunit beta, mitochondrial;...   196   3e-48
CP002526_4213(CP002526|pid:none) Glaciecola sp. 4H-3-7+YE-5, com...   196   3e-48
(A5G9D8) RecName: Full=ATP synthase subunit beta;          EC=3....   196   4e-48
(P55988) RecName: Full=ATP synthase subunit beta;          EC=3....   196   4e-48
(A3M144) RecName: Full=ATP synthase subunit beta;          EC=3....   196   4e-48
(Q1I2I7) RecName: Full=ATP synthase subunit beta;          EC=3....   196   4e-48
(A8EV70) RecName: Full=ATP synthase subunit beta;          EC=3....   196   4e-48
(A0L2S8) RecName: Full=ATP synthase subunit beta;          EC=3....   196   4e-48
K00560_1(K00560|pid:none) yeast (s.cerevisiae) mitochondrial atp...   196   4e-48
CP001607_1869(CP001607|pid:none) Aggregatibacter aphrophilus NJ8...   196   4e-48
GQ330991_1(GQ330991|pid:none) Haliclona sp. KJP-2009 ATP synthas...   196   4e-48
(A4J999) RecName: Full=ATP synthase subunit beta;          EC=3....   196   4e-48
(B0BRX2) RecName: Full=ATP synthase subunit beta;          EC=3....   196   4e-48
(Q5HB71) RecName: Full=ATP synthase subunit beta;          EC=3....   196   4e-48
CP002336_1047(CP002336|pid:none) Helicobacter pylori SouthAfrica...   195   5e-48
AP012224_3686(AP012224|pid:none) Pseudogulbenkiania sp. NH8B DNA...   195   5e-48
FN545181_31(FN545181|pid:none) Arsenophonus nasoniae whole genom...   195   5e-48
(B5Z8D0) RecName: Full=ATP synthase subunit beta;          EC=3....   195   5e-48
FM991728_1057(FM991728|pid:none) Helicobacter pylori B38 complet...   195   5e-48
CP002433_3940(CP002433|pid:none) Pantoea sp. At-9b, complete gen...   195   5e-48
CP002074_1048(CP002074|pid:none) Helicobacter pylori PeCan4, com...   195   5e-48
(Q9ZK81) RecName: Full=ATP synthase subunit beta;          EC=3....   195   5e-48
(A6VF32) RecName: Full=ATP synthase subunit beta;          EC=3....   195   5e-48
FN598874_369(FN598874|pid:none) Helicobacter pylori B8 complete ...   195   5e-48
(Q9JXQ2) RecName: Full=ATP synthase subunit beta;          EC=3....   195   6e-48
AM889136_230(AM889136|pid:none) Neisseria meningitidis alpha14 c...   195   6e-48
CP002870_5211(CP002870|pid:none) Pseudomonas putida S16, complet...   195   6e-48
(Q67TB7) RecName: Full=ATP synthase subunit beta;          EC=3....   195   6e-48
(A5WBA3) RecName: Full=ATP synthase subunit beta;          EC=3....   195   6e-48
(A6QB59) RecName: Full=ATP synthase subunit beta;          EC=3....   195   6e-48
FN995097_1835(FN995097|pid:none) Neisseria lactamica 020-06 comp...   195   6e-48
DQ403114_1(DQ403114|pid:none) Diceros bicornis mitochondrial ATP...   194   8e-48
CP001931_1284(CP001931|pid:none) Thermocrinis albus DSM 14484, c...   194   8e-48
D64071(D64071)H+-transporting two-sector ATPase (EC 3.6.3.14) be...   194   8e-48
CP002206_3178(CP002206|pid:none) Pantoea vagans C9-1, complete g...   194   8e-48
(Q17Y78) RecName: Full=ATP synthase subunit beta;          EC=3....   194   8e-48
CP001055_1501(CP001055|pid:none) Elusimicrobium minutum Pei191, ...   194   8e-48
(B1KQ34) RecName: Full=ATP synthase subunit beta;          EC=3....   194   8e-48
CP002607_4005(CP002607|pid:none) Aeromonas veronii B565, complet...   194   8e-48
(A3N2U4) RecName: Full=ATP synthase subunit beta;          EC=3....   194   8e-48
CP002371_65(CP002371|pid:none) Candidatus Liberibacter solanacea...   194   8e-48
CP002109_3864(CP002109|pid:none) Clostridium saccharolyticum WM1...   194   8e-48
(B9L7Y7) RecName: Full=ATP synthase subunit beta;          EC=3....   194   8e-48
CP002739_1778(CP002739|pid:none) Thermoanaerobacterium xylanolyt...   194   8e-48
(P43715) RecName: Full=ATP synthase subunit beta;          EC=3....   194   8e-48
(B3PIS7) RecName: Full=ATP synthase subunit beta;          EC=3....   194   8e-48
CP002736_2542(CP002736|pid:none) Desulfotomaculum carboxydivoran...   194   8e-48
(A9KBF7) RecName: Full=ATP synthase subunit beta;          EC=3....   194   1e-47
CP001859_1656(CP001859|pid:none) Acidaminococcus fermentans DSM ...   194   1e-47
(Q2S6P1) RecName: Full=ATP synthase subunit beta;          EC=3....   194   1e-47
DQ403105_1(DQ403105|pid:none) Oryctolagus cuniculus mitochondria...   194   1e-47
FN392235_3975(FN392235|pid:none) Erwinia pyrifoliae DSM 12163 co...   194   1e-47
(Q3SF66) RecName: Full=ATP synthase subunit beta;          EC=3....   194   1e-47
AE016828_1691(AE016828|pid:none) Coxiella burnetii RSA 493, comp...   194   1e-47
FN869568_3445(FN869568|pid:none) Halomonas elongata DSM 2581, co...   194   1e-47
CP002124_1165(CP002124|pid:none) Erwinia sp. Ejp617, complete ge...   194   1e-47
DQ403116_1(DQ403116|pid:none) Balaenoptera physalus mitochondria...   194   1e-47
(B0TWS7) RecName: Full=ATP synthase subunit beta;          EC=3....   194   1e-47
AP011177_4335(AP011177|pid:none) Shewanella violacea DSS12 DNA, ...   194   1e-47
CP001132_2731(CP001132|pid:none) Acidithiobacillus ferrooxidans ...   194   1e-47
(P41168) RecName: Full=ATP synthase subunit beta;          EC=3....   194   1e-47
(A5III3) RecName: Full=ATP synthase subunit beta;          EC=3....   194   1e-47
(Q6FYM3) RecName: Full=ATP synthase subunit beta;          EC=3....   194   1e-47
CP002547_3153(CP002547|pid:none) Syntrophobotulus glycolicus DSM...   194   1e-47
(Q8RC15) RecName: Full=ATP synthase subunit beta;          EC=3....   193   2e-47
CP002032_655(CP002032|pid:none) Thermoanaerobacter mathranii sub...   193   2e-47
(A3DIM9) RecName: Full=ATP synthase subunit beta;          EC=3....   193   2e-47
CP002332_1094(CP002332|pid:none) Helicobacter pylori Gambia94/24...   193   2e-47
(C4LDW0) RecName: Full=ATP synthase subunit beta;          EC=3....   193   2e-47
CP002048_2215(CP002048|pid:none) Syntrophothermus lipocalidus DS...   193   2e-47
GN102175_1(GN102175|pid:none) Sequence 6956 from Patent WO200903...   193   2e-47
FP236843_4587(FP236843|pid:none) Erwinia billingiae strain Eb661...   193   2e-47
(A3QJR0) RecName: Full=ATP synthase subunit beta;          EC=3....   193   2e-47
CP002205_776(CP002205|pid:none) Sulfurimonas autotrophica DSM 16...   193   2e-47
AB206839_8(AB206839|pid:none) Acidithiobacillus ferrooxidans atp...   193   2e-47
CP000554_498(CP000554|pid:none) Prochlorococcus marinus str. MIT...   193   2e-47
AP011941_256(AP011941|pid:none) Helicobacter pylori F30 DNA, com...   193   2e-47
CP002331_1064(CP002331|pid:none) Helicobacter pylori India7, com...   193   2e-47
AP011943_1067(AP011943|pid:none) Helicobacter pylori F32 DNA, co...   193   2e-47
CP002983_1066(CP002983|pid:none) Helicobacter pylori SNT49, comp...   193   2e-47
(A0Q8D9) RecName: Full=ATP synthase subunit beta;          EC=3....   193   2e-47
FP929038_633(FP929038|pid:none) Coprococcus catus GD/7 draft gen...   193   2e-47
CP001157_5023(CP001157|pid:none) Azotobacter vinelandii DJ, comp...   193   2e-47
CP002076_1103(CP002076|pid:none) Helicobacter pylori Cuz20, comp...   193   2e-47
(A6LJR1) RecName: Full=ATP synthase subunit beta;          EC=3....   193   2e-47
CP001582_1087(CP001582|pid:none) Helicobacter pylori v225d, comp...   193   2e-47
(A6W3S8) RecName: Full=ATP synthase subunit beta 2;          EC=...   193   2e-47
CP002982_1108(CP002982|pid:none) Helicobacter pylori Puno135, co...   193   2e-47
CP002980_1038(CP002980|pid:none) Helicobacter pylori Puno120, co...   193   2e-47
CP001072_1103(CP001072|pid:none) Helicobacter pylori Shi470, com...   193   2e-47
(B2VCA4) RecName: Full=ATP synthase subunit beta;          EC=3....   193   2e-47
(A2C6Z4) RecName: Full=ATP synthase subunit beta;          EC=3....   193   2e-47
CP002073_1076(CP002073|pid:none) Helicobacter pylori SJM180, com...   193   2e-47
(C5BKJ5) RecName: Full=ATP synthase subunit beta;          EC=3....   193   2e-47
(Q10Z38) RecName: Full=ATP synthase subunit beta;          EC=3....   193   2e-47
GQ330988_1(GQ330988|pid:none) Haliclona (Haliclona) sp. KJP-2009...   192   3e-47
(Q9JW70) RecName: Full=ATP synthase subunit beta;          EC=3....   192   3e-47
(A7G9Q9) RecName: Full=ATP synthase subunit beta;          EC=3....   192   3e-47
DQ403111_1(DQ403111|pid:none) Felis catus mitochondrial ATP synt...   192   3e-47
CP002351_276(CP002351|pid:none) Thermotoga thermarum DSM 5069, c...   192   3e-47
CP001685_618(CP001685|pid:none) Leptotrichia buccalis DSM 1135, ...   192   4e-47
CP002432_2210(CP002432|pid:none) Desulfurispirillum indicum S5, ...   192   4e-47
AK362825_1(AK362825|pid:none) Hordeum vulgare subsp. vulgare mRN...   192   4e-47
AK365943_1(AK365943|pid:none) Hordeum vulgare subsp. vulgare mRN...   192   4e-47
GN102169_1(GN102169|pid:none) Sequence 6950 from Patent WO200903...   192   4e-47
(A7HJV7) RecName: Full=ATP synthase subunit beta;          EC=3....   192   5e-47
AY774529_1(AY774529|pid:none) Synthetic construct Francisella tu...   192   5e-47
(B7IG44) RecName: Full=ATP synthase subunit beta;          EC=3....   191   7e-47
CP002552_335(CP002552|pid:none) Nitrosomonas sp. AL212, complete...   191   7e-47
FO082060_331(FO082060|pid:none) Methylomicrobium alcaliphilum st...   191   7e-47
CP001769_5023(CP001769|pid:none) Spirosoma linguale DSM 74, comp...   191   7e-47
CR940347_800(CR940347|pid:none) Theileria annulata strain Ankara...   191   7e-47
GQ330997_1(GQ330997|pid:none) Suberites sp. KJP-2009 ATP synthas...   191   7e-47
(B1KSS8) RecName: Full=ATP synthase subunit beta;          EC=3....   191   7e-47
(A8ZUA1) RecName: Full=ATP synthase subunit beta;          EC=3....   191   7e-47
(C1FQP5) RecName: Full=ATP synthase subunit beta;          EC=3....   191   7e-47
(Q2YCA3) RecName: Full=ATP synthase subunit beta 1;          EC=...   191   7e-47
(P26527) RecName: Full=ATP synthase subunit beta;          EC=3....   191   7e-47
FJ827069_1(FJ827069|pid:none) Gallibacterium anatis strain Yu-ZZ...   191   9e-47
CP002606_977(CP002606|pid:none) Hippea maritima DSM 10411, compl...   191   9e-47
(B2UZK0) RecName: Full=ATP synthase subunit beta;          EC=3....   191   9e-47
CP001720_3868(CP001720|pid:none) Desulfotomaculum acetoxidans DS...   191   9e-47
(Q7U8U7) RecName: Full=ATP synthase subunit beta;          EC=3....   191   9e-47
(A8F3K2) RecName: Full=ATP synthase subunit beta;          EC=3....   191   9e-47
GN102165_1(GN102165|pid:none) Sequence 6946 from Patent WO200903...   191   9e-47
(A6TK65) RecName: Full=ATP synthase subunit beta;          EC=3....   191   9e-47
(B2TK00) RecName: Full=ATP synthase subunit beta;          EC=3....   191   9e-47
CP002573_33(CP002573|pid:none) Acidithiobacillus caldus SM-1, co...   191   9e-47
(Q48AW0) RecName: Full=ATP synthase subunit beta;          EC=3....   191   9e-47
EU074273_1(EU074273|pid:none) Terebratulina retusa mitochondrial...   191   1e-46
(P29707) RecName: Full=ATP synthase subunit beta, sodium ion spe...   191   1e-46
CP001275_1178(CP001275|pid:none) Thermomicrobium roseum DSM 5159...   191   1e-46
FR695877_403(FR695877|pid:none) Uncultured Desulfobacterium sp. ...   191   1e-46
CP002209_3765(CP002209|pid:none) Ferrimonas balearica DSM 9799, ...   191   1e-46
(A4VS62) RecName: Full=ATP synthase subunit beta;          EC=3....   191   1e-46
CP000012_1003(CP000012|pid:none) Helicobacter pylori 51, complet...   191   1e-46
CP002582_3540(CP002582|pid:none) Clostridium lentocellum DSM 542...   191   1e-46
AE013598_719(AE013598|pid:none) Xanthomonas oryzae pv. oryzae KA...   190   2e-46
GQ330913_1(GQ330913|pid:none) Dysidea sp. KJP-2009 ATP synthase ...   190   2e-46
CP001814_1600(CP001814|pid:none) Streptosporangium roseum DSM 43...   190   2e-46
AY580175_1(AY580175|pid:none) Asterina miniata ATP synthase beta...   190   2e-46
(B2SQB0) RecName: Full=ATP synthase subunit beta;          EC=3....   190   2e-46
CP003057_3733(CP003057|pid:none) Xanthomonas oryzae pv. oryzicol...   190   2e-46
CP002056_2746(CP002056|pid:none) Methylotenera versatilis 301, c...   190   2e-46
(Q8PGG7) RecName: Full=ATP synthase subunit beta;          EC=3....   190   2e-46
(Q1GXN0) RecName: Full=ATP synthase subunit beta;          EC=3....   190   2e-46
FP929140_3794(FP929140|pid:none) gamma proteobacterium HdN1, com...   190   2e-46
CP001674_2803(CP001674|pid:none) Methylovorus glucosetrophus SIP...   190   2e-46
CP003029_68(CP003029|pid:none) Rhodothermus marinus SG0.5JP17-17...   190   2e-46
AP011940_1074(AP011940|pid:none) Helicobacter pylori F16 DNA, co...   190   2e-46
AP009049_3253(AP009049|pid:none) Clostridium kluyveri NBRC 12016...   190   2e-46
CP003093_2736(CP003093|pid:none) Pseudoxanthomonas spadix BD-a59...   190   2e-46
(A5GNB1) RecName: Full=ATP synthase subunit beta;          EC=3....   190   2e-46
(Q32RY8) RecName: Full=ATP synthase subunit beta, chloroplastic;...   190   2e-46
CP002738_4387(CP002738|pid:none) Methylomonas methanica MC09, co...   190   2e-46
CP001807_73(CP001807|pid:none) Rhodothermus marinus DSM 4252, co...   190   2e-46
(Q3AHM2) RecName: Full=ATP synthase subunit beta;          EC=3....   190   2e-46
(A5N3H7) RecName: Full=ATP synthase subunit beta;          EC=3....   190   2e-46
(Q03EL4) RecName: Full=ATP synthase subunit beta;          EC=3....   189   3e-46
(A9BFX3) RecName: Full=ATP synthase subunit beta;          EC=3....   189   3e-46
GQ464994_1(GQ464994|pid:none) Gallibacterium anatis strain Yu-ZM...   189   3e-46
(A3PES6) RecName: Full=ATP synthase subunit beta;          EC=3....   189   3e-46
(A9AVV4) RecName: Full=ATP synthase subunit beta;          EC=3....   189   3e-46
(Q82XP8) RecName: Full=ATP synthase subunit beta;          EC=3....   189   3e-46
DQ087459_1(DQ087459|pid:none) Sycon lingua ATP synthase beta sub...   189   3e-46
CP002543_1228(CP002543|pid:none) Desulfurobacterium thermolithot...   189   3e-46
CP001220_336(CP001220|pid:none) Comamonas testosteroni CNB-2, co...   189   3e-46
(C1F3N6) RecName: Full=ATP synthase subunit beta;          EC=3....   189   3e-46
(Q21DK8) RecName: Full=ATP synthase subunit beta;          EC=3....   189   3e-46
CP001796_3058(CP001796|pid:none) Pseudoalteromonas sp. SM9913 ch...   189   3e-46
CP002159_2880(CP002159|pid:none) Gallionella capsiferriformans E...   189   3e-46
CP000815_200(CP000815|pid:none) Paulinella chromatophora chromat...   189   3e-46
(Q0AJB0) RecName: Full=ATP synthase subunit beta 1;          EC=...   189   3e-46
DQ087473_1(DQ087473|pid:none) Microciona prolifera ATP synthase ...   189   3e-46
(Q3IK50) RecName: Full=ATP synthase subunit beta;          EC=3....   189   3e-46
FJ707530_1(FJ707530|pid:none) Dissiliaria muelleri ATP synthase ...   189   4e-46
(Q318V4) RecName: Full=ATP synthase subunit beta;          EC=3....   189   4e-46
CP001978_3679(CP001978|pid:none) Marinobacter adhaerens HP15, co...   189   4e-46
FP929052_640(FP929052|pid:none) Ruminococcus sp. 18P13 draft gen...   189   4e-46
(B8D6S7) RecName: Full=ATP synthase subunit beta;          EC=3....   189   4e-46
AY296243_1(AY296243|pid:none) Actinobacillus rossii ATP synthase...   189   4e-46
(Q7VA76) RecName: Full=ATP synthase subunit beta;          EC=3....   188   6e-46
(Q07232) RecName: Full=ATP synthase subunit beta;          EC=3....   188   6e-46
FP929044_2114(FP929044|pid:none) Eubacterium siraeum 70/3 draft ...   188   6e-46
(B0U598) RecName: Full=ATP synthase subunit beta;          EC=3....   188   6e-46
(A0LSL6) RecName: Full=ATP synthase subunit beta;          EC=3....   188   6e-46
DQ859784_1(DQ859784|pid:none) Ewingella americana strain ICMP 15...   188   6e-46
(Q11Y90) RecName: Full=ATP synthase subunit beta;          EC=3....   188   6e-46
(Q9PE85) RecName: Full=ATP synthase subunit beta;          EC=3....   188   6e-46
CP002599_90(CP002599|pid:none) Burkholderia gladioli BSR3 chromo...   188   6e-46
CP002025_493(CP002025|pid:none) Brachyspira pilosicoli 95/1000, ...   188   6e-46
FP929061_1945(FP929061|pid:none) Clostridiales sp. SSC/2 draft g...   188   6e-46
AY580244_1(AY580244|pid:none) Metridium senile ATP synthase beta...   188   6e-46
(Q494C3) RecName: Full=ATP synthase subunit beta;          EC=3....   188   8e-46

>BT127859_1(BT127859|pid:none) Dendroctonus ponderosae clone
            DPO123_G12 unknown mRNA.
          Length = 515

 Score =  218 bits (556), Expect = 5e-55
 Identities = 112/152 (73%), Positives = 125/152 (82%)
 Frame = +1

Query: 697  FAHLDATTVLSRAISELGIYPCVDPLDSTSLMMDPNIIGVEHYKVATDVQKILQEYKSLQ 876
            FAHLDATTVLSRAI+ELGIYP VDPLDSTS +MDPNIIG EHY +A  VQKILQ+YKSLQ
Sbjct: 364  FAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIIGQEHYNIARGVQKILQDYKSLQ 423

Query: 877  DIIAILGMDDLSEDQKATVFRARKIQRFLSQPFEVAHAFTNMEGRFVKLSDSIKAFKGIL 1056
            DIIAILGMD+LSED K TV RARKIQRFLSQPF+VA  FT   G+ V L ++IK F+ IL
Sbjct: 424  DIIAILGMDELSEDDKLTVARARKIQRFLSQPFQVAEVFTGHPGKLVPLEETIKGFQKIL 483

Query: 1057 EGKYDHLPEAAFYMVGGIEDVEIKAAKLLESA 1152
             G YDHLPE AFYMVG IE+V  KA KL E++
Sbjct: 484  GGDYDHLPEVAFYMVGPIEEVVQKAEKLAETS 515

 Score = 87.4 bits (215), Expect = 2e-15
 Identities = 63/152 (41%), Positives = 82/152 (53%)
 Frame = +2

Query: 188 YFEKNKSLLDKESNEESTEVDYSKLNENQGVVHQVIGAVVDVYFPHGKLPYINDALIVDD 367
           +F++N++L  K +  ++           +G +  VIGAVVDV F    LP I +AL V
Sbjct: 31  HFQQNRTLAAKAAAGQA-----------KGRIVAVIGAVVDVQF-EDDLPPILNALEVA- 77

Query: 368 FQAENVEKVIEDLNNPSLKGKIDFNNVPISNIKLVLEVAQHLGDGIVRCVALDITDGLGR 547
                                   N  P    +LVLEVAQHLG+  VR +A+D T+GL R
Sbjct: 78  ------------------------NRSP----RLVLEVAQHLGENTVRTIAMDGTEGLVR 109

Query: 548 GALVLNTGSPLMVPVGQATLGRIMNVIGEPID 643
           G  VL+TG P+ +PVG  TLGRIMNVIGEPID
Sbjct: 110 GQNVLDTGYPIRIPVGVETLGRIMNVIGEPID 141

Lambda     K      H
   0.318    0.134    0.401

Gapped
Lambda     K      H
   0.267   0.0410    0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 5349213
Number of Hits to DB: 3,445,899,886
Number of extensions: 68666322
Number of successful extensions: 218877
Number of sequences better than 10.0: 7466
Number of HSP's gapped: 216230
Number of HSP's successfully gapped: 11386
Length of query: 472
Length of database: 1,732,582,204
Length adjustment: 136
Effective length of query: 336
Effective length of database: 1,005,089,236
Effective search space: 337709983296
Effective search space used: 337709983296
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)




Dictyostelium discoideum cDNA Project Home