Homology SSC204 vs Protein

Query= SSC204 (SSC204Q) /CSM/SS/SSC2-A/SSC204Q.Seq.d/
         (670 letters)

Database: nrp_B
           5,349,213 sequences; 1,732,582,204 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AC116984_190(AC116984|pid:none) Dictyostelium discoideum chromos...   324   3e-87
CP002464_1756(CP002464|pid:none) Lactobacillus johnsonii DPC 602...   170   6e-41
(Q64446) RecName: Full=Copper-transporting ATPase 2;          EC...   168   2e-40
U38477_1(U38477|pid:none) Mus musculus copper-transporting ATPas...   168   2e-40
AB017791_1(AB017791|pid:none) Rattus norvegicus mRNA for ATPase ...   168   2e-40
AL590619_2(AL590619|pid:none) Mouse DNA sequence from clone RP23...   168   2e-40
CP001685_565(CP001685|pid:none) Leptotrichia buccalis DSM 1135, ...   167   3e-40
CP000517_1601(CP000517|pid:none) Lactobacillus helveticus DPC 45...   167   3e-40
AP007281_425(AP007281|pid:none) Lactobacillus reuteri JCM 1112 D...   167   3e-40
BC143973_1(BC143973|pid:none) Homo sapiens ATPase, Cu++ transpor...   167   5e-40
BC143975_1(BC143975|pid:none) Homo sapiens ATPase, Cu++ transpor...   167   5e-40
(P35670) RecName: Full=Copper-transporting ATPase 2;          EC...   167   5e-40
BC143976_1(BC143976|pid:none) Homo sapiens ATPase, Cu++ transpor...   167   5e-40
L25591_2(L25591|pid:none) Homo sapiens (PWD) gene mRNA, 3' end.       167   5e-40
S78555(S78555;S40526;S78552;S78553;JC2027;I58117) copper-transpo...   167   5e-40
FN692037_2010(FN692037|pid:none) Lactobacillus crispatus ST1 com...   166   7e-40
FR824055_36(FR824055|pid:none) Albugo laibachii Nc14, genomic co...   166   1e-39
AB172173_1(AB172173|pid:none) Macaca fascicularis brain cDNA clo...   165   2e-39
AF032881_1(AF032881|pid:none) Ovis aries ATP7B mRNA, complete cds.    165   2e-39
CP002372_1374(CP002372|pid:none) Thermococcus barophilus MP, com...   164   3e-39
CP000413_1733(CP000413|pid:none) Lactobacillus gasseri ATCC 3332...   164   3e-39
HE575363_6(HE575363|pid:none) Caloramator australicus RC3 annota...   164   3e-39
(Q64535) RecName: Full=Copper-transporting ATPase 2;          EC...   164   3e-39
S40525(S40525)copper-transporting ATPase (EC 3.6.1.-) beta chain...   164   3e-39
FP929048_1934(FP929048|pid:none) Megamonas hypermegale ART12/1 d...   164   5e-39
CP002219_453(CP002219|pid:none) Caldicellulosiruptor hydrotherma...   164   5e-39
CP002109_2502(CP002109|pid:none) Clostridium saccharolyticum WM1...   163   6e-39
CP001634_1056(CP001634|pid:none) Kosmotoga olearia TBF 19.5.1, c...   163   6e-39
AB457043_1(AB457043|pid:none) Ascidia sydneiensis samea AsHMA1 m...   163   6e-39
S43793(S43793;S43792) copper-transporting ATPase (EC 3.6.1.-) - ...   163   6e-39
CP001110_1465(CP001110|pid:none) Pelodictyon phaeoclathratiforme...   163   8e-39
L06133_1(L06133|pid:none) Human putative Cu++-transporting P-typ...   163   8e-39
S36149(S36149;S37287;S36151;S37288;S36150;A56832) copper-transpo...   163   8e-39
AK299449_1(AK299449|pid:none) Homo sapiens cDNA FLJ58125 complet...   163   8e-39
(Q64430) RecName: Full=Copper-transporting ATPase 1;          EC...   162   1e-38
HM565231_2(HM565231|pid:none) Enterococcus faecium strain 64/3xU...   162   1e-38
AB007134_1(AB007134|pid:none) Mus musculus mRNA for Cu++-tranpor...   162   1e-38
AB271958_1(AB271958|pid:none) Sus scrofa ATP7A mRNA for ATPase, ...   162   1e-38
CP002764_1482(CP002764|pid:none) Lactobacillus kefiranofaciens Z...   162   2e-38
BC141395_1(BC141395|pid:none) Mus musculus ATPase, Cu++ transpor...   162   2e-38
(P70705) RecName: Full=Copper-transporting ATPase 1;          EC...   162   2e-38
HQ206461_1(HQ206461|pid:none) Perca flavescens clone Pf_150 copp...   161   2e-38
AP008937_140(AP008937|pid:none) Lactobacillus fermentum IFO 3956...   161   3e-38
CP002779_846(CP002779|pid:none) Pyrococcus yayanosii CH1, comple...   161   3e-38
CP002588_2025(CP002588|pid:none) Archaeoglobus veneficus SNP6, c...   161   3e-38
CP000855_840(CP000855|pid:none) Thermococcus onnurineus NA1, com...   161   3e-38
CP001739_3623(CP001739|pid:none) Sebaldella termitidis ATCC 3338...   160   4e-38
CP001719_206(CP001719|pid:none) Methanobrevibacter ruminantium M...   160   4e-38
CP001393_2185(CP001393|pid:none) Caldicellulosiruptor bescii DSM...   160   5e-38
CP002772_1183(CP002772|pid:none) Methanobacterium sp. SWAN-1, co...   160   5e-38
CP002606_732(CP002606|pid:none) Hippea maritima DSM 10411, compl...   160   7e-38
CP002330_332(CP002330|pid:none) Caldicellulosiruptor kronotskyen...   160   7e-38
CP002034_1322(CP002034|pid:none) Lactobacillus salivarius CECT 5...   159   9e-38
CP002164_1924(CP002164|pid:none) Caldicellulosiruptor obsidiansi...   159   9e-38
CP002739_595(CP002739|pid:none) Thermoanaerobacterium xylanolyti...   159   9e-38
EU877769_1(EU877769|pid:none) Arabidopsis thaliana ecotype Can-0...   159   1e-37
EU877766_1(EU877766|pid:none) Arabidopsis thaliana ecotype Bu-4 ...   159   1e-37
EU877765_1(EU877765|pid:none) Arabidopsis thaliana ecotype Br-0 ...   159   1e-37
CP002069_1733(CP002069|pid:none) Methanohalobium evestigatum Z-7...   159   1e-37
AC008047_18(AC008047|pid:none) Genomic sequence for Arabidopsis ...   159   1e-37
EU877772_1(EU877772|pid:none) Arabidopsis thaliana ecotype Gie-0...   159   1e-37
(Q9SH30) RecName: Full=Putative copper-transporting ATPase 3;   ...   159   1e-37
EU877793_1(EU877793|pid:none) Arabidopsis thaliana ecotype Chi-2...   159   1e-37
CP002171_702(CP002171|pid:none) Thermoanaerobacterium thermosacc...   159   1e-37
CP001899_723(CP001899|pid:none) Ferroglobus placidus DSM 10642, ...   159   1e-37
Z94801_1(Z94801|pid:none) Human DNA sequence from PAC 465G10 on ...   159   1e-37
AY603039_1(AY603039|pid:none) Canis familiaris copper-transporti...   158   2e-37
CP001698_1464(CP001698|pid:none) Spirochaeta thermophila DSM 619...   158   2e-37
CP002326_2157(CP002326|pid:none) Caldicellulosiruptor kristjanss...   158   2e-37
CP000885_3833(CP000885|pid:none) Clostridium phytofermentans ISD...   158   2e-37
CP000725_288(CP000725|pid:none) Streptococcus gordonii str. Chal...   158   2e-37
AP012202_241(AP012202|pid:none) Candidatus Arthromitus sp. SFB-m...   158   2e-37
CP002069_993(CP002069|pid:none) Methanohalobium evestigatum Z-73...   157   3e-37
CP002609_1830(CP002609|pid:none) Lactobacillus amylovorus GRL111...   157   3e-37
EU908861_1(EU908861|pid:none) Opsanus beta Cu++ transporting ATP...   157   3e-37
CP002372_1385(CP002372|pid:none) Thermococcus barophilus MP, com...   157   3e-37
AL935261_9(AL935261|pid:none) Lactobacillus plantarum strain WCF...   157   3e-37
CP002559_2012(CP002559|pid:none) Lactobacillus acidophilus 30SC,...   157   3e-37
CP002338_2043(CP002338|pid:none) Lactobacillus amylovorus GRL 11...   157   3e-37
FR773526_1361(FR773526|pid:none) Clostridium botulinum H04402 06...   157   4e-37
CP000939_1300(CP000939|pid:none) Clostridium botulinum B1 str. O...   157   4e-37
AL032665_2(AL032665|pid:none) Caenorhabditis elegans YAC Y76A2A,...   157   4e-37
CP000743_292(CP000743|pid:none) Methanococcus aeolicus Nankai-3,...   157   6e-37
CP001083_1237(CP001083|pid:none) Clostridium botulinum Ba4 str. ...   157   6e-37
EU877802_1(EU877802|pid:none) Arabidopsis thaliana ecotype Cvi-1...   157   6e-37
AM412317_1298(AM412317|pid:none) Clostridium botulinum A str. AT...   157   6e-37
AM483223_1(AM483223|pid:none) Vitis vinifera contig VV78X068121....   156   7e-37
CP002175_1380(CP002175|pid:none) Halanaerobium praevalens DSM 22...   156   7e-37
CP002621_241(CP002621|pid:none) Enterococcus faecalis OG1RF, com...   156   7e-37
CP002779_877(CP002779|pid:none) Pyrococcus yayanosii CH1, comple...   156   7e-37
FP929058_1943(FP929058|pid:none) Enterococcus sp. 7L76 draft gen...   156   7e-37
CP000679_208(CP000679|pid:none) Caldicellulosiruptor saccharolyt...   156   7e-37
CP002491_653(CP002491|pid:none) Enterococcus faecalis 62, comple...   156   7e-37
CP000156_555(CP000156|pid:none) Lactobacillus delbrueckii subsp....   156   9e-37
CP000416_262(CP000416|pid:none) Lactobacillus brevis ATCC 367, c...   156   9e-37
CP002920_148(CP002920|pid:none) Thermococcus sp. 4557, complete ...   156   9e-37
A97952(A97952) H+/K+-exchanging ATPase (EC 3.6.3.10) [imported] ...   155   1e-36
CP000300_559(CP000300|pid:none) Methanococcoides burtonii DSM 62...   155   1e-36
CP001581_1349(CP001581|pid:none) Clostridium botulinum A2 str. K...   155   1e-36
CP000410_597(CP000410|pid:none) Streptococcus pneumoniae D39, co...   155   1e-36
FN568063_1368(FN568063|pid:none) Streptococcus mitis B6 complete...   155   1e-36
CP000918_735(CP000918|pid:none) Streptococcus pneumoniae 70585, ...   155   1e-36
DQ100352_1(DQ100352|pid:none) Danio rerio Menkes disease ATPase ...   155   2e-36
AP008230_4510(AP008230|pid:none) Desulfitobacterium hafniense Y5...   155   2e-36
CP002792_27(CP002792|pid:none) Methanothermococcus okinawensis I...   155   2e-36
CP002121_698(CP002121|pid:none) Streptococcus pneumoniae AP200, ...   155   2e-36
FQ312029_643(FQ312029|pid:none) Streptococcus pneumoniae INV200 ...   155   2e-36
CP002925_734(CP002925|pid:none) Streptococcus pseudopneumoniae I...   155   2e-36
CP000382_1420(CP000382|pid:none) Clostridium novyi NT, complete ...   155   2e-36
CP001033_678(CP001033|pid:none) Streptococcus pneumoniae CGSP14,...   155   2e-36
FM211187_634(FM211187|pid:none) Streptococcus pneumoniae ATCC 70...   155   2e-36
CP001707_1346(CP001707|pid:none) Kangiella koreensis DSM 16069, ...   154   3e-36
CP001841_236(CP001841|pid:none) Treponema azotonutricium ZAS-9, ...   154   3e-36
CP002670_1582(CP002670|pid:none) Pyrococcus sp. NA2, complete ge...   154   3e-36
CP002341_584(CP002341|pid:none) Lactobacillus delbrueckii subsp....   154   3e-36
CP000854_1430(CP000854|pid:none) Mycobacterium marinum M, comple...   154   3e-36
AP008230_2564(AP008230|pid:none) Desulfitobacterium hafniense Y5...   154   4e-36
CP000923_754(CP000923|pid:none) Thermoanaerobacter sp. X514, com...   154   4e-36
(O29777) RecName: Full=Probable copper-exporting P-type ATPase A...   154   5e-36
CP001336_3673(CP001336|pid:none) Desulfitobacterium hafniense DC...   154   5e-36
HE575159_38(HE575159|pid:none) Weissella thailandensis fsh4-2 an...   154   5e-36
FP929050_125(FP929050|pid:none) Roseburia intestinalis XB6B4 dra...   154   5e-36
FQ312027_657(FQ312027|pid:none) Streptococcus pneumoniae OXC141 ...   153   6e-36
CP001124_2171(CP001124|pid:none) Geobacter bemidjiensis Bem, com...   153   6e-36
CP001993_1013(CP001993|pid:none) Streptococcus pneumoniae TCH843...   153   6e-36
CP002105_1900(CP002105|pid:none) Acetohalobium arabaticum DSM 55...   153   6e-36
CP002670_1572(CP002670|pid:none) Pyrococcus sp. NA2, complete ge...   153   6e-36
CP000879_1813(CP000879|pid:none) Petrotoga mobilis SJ95, complet...   153   8e-36
CP002565_15(CP002565|pid:none) Methanosaeta concilii GP-6, compl...   152   1e-35
CP000806_1915(CP000806|pid:none) Cyanothece sp. ATCC 51142 circu...   152   1e-35
CP000359_87(CP000359|pid:none) Deinococcus geothermalis DSM 1130...   152   1e-35
CP002410_1591(CP002410|pid:none) Clostridium botulinum BKT015925...   152   1e-35
CP000919_629(CP000919|pid:none) Streptococcus pneumoniae JJA, co...   152   1e-35
CP000896_1097(CP000896|pid:none) Acholeplasma laidlawii PG-8A, c...   152   1e-35
CP002479_2041(CP002479|pid:none) Geobacter sp. M18, complete gen...   152   1e-35
CP001661_2017(CP001661|pid:none) Geobacter sp. M21, complete gen...   152   1e-35
CP001936_1574(CP001936|pid:none) Thermoanaerobacter italicus Ab9...   152   1e-35
CP001344_1766(CP001344|pid:none) Cyanothece sp. PCC 7425, comple...   152   1e-35
CP001878_2002(CP001878|pid:none) Bacillus pseudofirmus OF4, comp...   152   1e-35
CP000853_54(CP000853|pid:none) Alkaliphilus oremlandii OhILAs, c...   152   1e-35
BT014649_1(BT014649|pid:none) Drosophila melanogaster RE21490 fu...   152   2e-35
AE016828_1301(AE016828|pid:none) Coxiella burnetii RSA 493, comp...   152   2e-35
CP002736_378(CP002736|pid:none) Desulfotomaculum carboxydivorans...   152   2e-35
CP001807_1513(CP001807|pid:none) Rhodothermus marinus DSM 4252, ...   151   2e-35
CP001666_2434(CP001666|pid:none) Clostridium ljungdahlii DSM 135...   151   2e-35
CP003029_1562(CP003029|pid:none) Rhodothermus marinus SG0.5JP17-...   151   2e-35
(P73241) RecName: Full=Cation-transporting ATPase PacS;         ...   151   2e-35
CP003108_496(CP003108|pid:none) Desulfosporosinus orientis DSM 7...   151   3e-35
CP000609_420(CP000609|pid:none) Methanococcus maripaludis C5, co...   151   3e-35
AE009950_740(AE009950|pid:none) Pyrococcus furiosus DSM 3638, co...   151   3e-35
AE017282_1962(AE017282|pid:none) Methylococcus capsulatus str. B...   151   3e-35
CP000557_1517(CP000557|pid:none) Geobacillus thermodenitrificans...   151   3e-35
AP004184_24(AP004184|pid:none) Oryza sativa Japonica Group genom...   151   3e-35
CP001186_3687(CP001186|pid:none) Bacillus cereus G9842, complete...   150   4e-35
CP001019_464(CP001019|pid:none) Coxiella burnetii CbuG_Q212, com...   150   4e-35
CP000733_452(CP000733|pid:none) Coxiella burnetii Dugway 5J108-1...   150   4e-35
CP001098_480(CP001098|pid:none) Halothermothrix orenii H 168, co...   150   4e-35
AE009951_831(AE009951|pid:none) Fusobacterium nucleatum subsp. n...   150   4e-35
FP565147_2666(FP565147|pid:none) uncultured archaeon ANME-1, uno...   150   4e-35
(Q9X5X3) RecName: Full=Copper-transporting P-type ATPase;       ...   150   5e-35
FP929039_856(FP929039|pid:none) Coprococcus sp. ART55/1 draft ge...   150   7e-35
CP002101_1973(CP002101|pid:none) Methanosalsum zhilinae DSM 4017...   150   7e-35
CP002216_1881(CP002216|pid:none) Caldicellulosiruptor owensensis...   150   7e-35
CP001087_4253(CP001087|pid:none) Desulfobacterium autotrophicum ...   150   7e-35
CP002281_1486(CP002281|pid:none) Ilyobacter polytropus DSM 2926,...   150   7e-35
AE017194_3727(AE017194|pid:none) Bacillus cereus ATCC 10987, com...   150   7e-35
CP000903_3400(CP000903|pid:none) Bacillus weihenstephanensis KBA...   149   9e-35
AE008691_2276(AE008691|pid:none) Thermoanaerobacter tengcongensi...   149   9e-35
EU952192_1(EU952192|pid:none) Zea mays clone 1219269 unknown mRNA.    149   9e-35
EF677956_1(EF677956|pid:none) Picea sitchensis clone WS02810_A18...   149   9e-35
AP006878_838(AP006878|pid:none) Thermococcus kodakarensis KOD1 D...   149   9e-35
CP002696_1818(CP002696|pid:none) Treponema brennaborense DSM 121...   149   9e-35
AE016877_3546(AE016877|pid:none) Bacillus cereus ATCC 14579, com...   149   1e-34
CP002738_2928(CP002738|pid:none) Methylomonas methanica MC09, co...   149   1e-34
CP002913_1303(CP002913|pid:none) Methanococcus maripaludis X1, c...   149   1e-34
AP012047_456(AP012047|pid:none) Arcobacter butzleri ED-1 DNA, co...   149   1e-34
CP002582_3861(CP002582|pid:none) Clostridium lentocellum DSM 542...   149   1e-34
CP000875_4306(CP000875|pid:none) Herpetosiphon aurantiacus DSM 7...   149   1e-34
FP929061_1375(FP929061|pid:none) Clostridiales sp. SSC/2 draft g...   149   1e-34
CP001099_831(CP001099|pid:none) Chlorobaculum parvum NCIB 8327, ...   149   1e-34
CP000252_496(CP000252|pid:none) Syntrophus aciditrophicus SB, co...   149   2e-34
AE015927_755(AE015927|pid:none) Clostridium tetani E88, complete...   149   2e-34
CP000721_4719(CP000721|pid:none) Clostridium beijerinckii NCIMB ...   149   2e-34
CP002028_2188(CP002028|pid:none) Thermincola sp. JR, complete ge...   149   2e-34
AP012054_331(AP012054|pid:none) Streptococcus pasteurianus ATCC ...   149   2e-34
CP002835_1725(CP002835|pid:none) Geobacillus thermoglucosidasius...   149   2e-34
CP000745_409(CP000745|pid:none) Methanococcus maripaludis C7, co...   149   2e-34
CP002394_3436(CP002394|pid:none) Bacillus cellulosilyticus DSM 2...   148   2e-34
CP001794_1619(CP001794|pid:none) Geobacillus sp. Y412MC61, compl...   148   2e-34
AH2543(AH2543) cation-transporting ATPase alr7635 [imported] - N...   148   2e-34
CP000232_1949(CP000232|pid:none) Moorella thermoacetica ATCC 390...   148   2e-34
CP001215_691(CP001215|pid:none) Bacillus anthracis str. CDC 684,...   148   3e-34
CP002588_1069(CP002588|pid:none) Archaeoglobus veneficus SNP6, c...   148   3e-34
CP001843_3243(CP001843|pid:none) Treponema primitia ZAS-2, compl...   148   3e-34
AE017355_3435(AE017355|pid:none) Bacillus thuringiensis serovar ...   148   3e-34
CP002772_1186(CP002772|pid:none) Methanobacterium sp. SWAN-1, co...   148   3e-34
CP001879_47(CP001879|pid:none) Bacillus pseudofirmus OF4 plasmid...   148   3e-34
CP001177_3589(CP001177|pid:none) Bacillus cereus AH187, complete...   148   3e-34
CP000485_3172(CP000485|pid:none) Bacillus thuringiensis str. Al ...   148   3e-34
CP000001_3450(CP000001|pid:none) Bacillus cereus E33L, complete ...   148   3e-34
CP001746_3479(CP001746|pid:none) Bacillus cereus biovar anthraci...   148   3e-34
CP002551_1087(CP002551|pid:none) Methanobacterium sp. AL-21, com...   147   3e-34
FP929056_217(FP929056|pid:none) Synergistetes sp. SGP1 draft gen...   147   3e-34
CP002904_438(CP002904|pid:none) Streptococcus equi subsp. zooepi...   147   3e-34
CP001959_1508(CP001959|pid:none) Brachyspira murdochii DSM 12563...   147   3e-34
CP000108_943(CP000108|pid:none) Chlorobium chlorochromatii CaD3,...   147   3e-34
CP002540_54(CP002540|pid:none) Deinococcus proteolyticus MRP pla...   147   3e-34
AM286690_2353(AM286690|pid:none) Alcanivorax borkumensis SK2, co...   147   3e-34
BT042968_1(BT042968|pid:none) Zea mays full-length cDNA clone ZM...   147   3e-34
CP000724_1063(CP000724|pid:none) Alkaliphilus metalliredigens QY...   147   4e-34
CP001348_736(CP001348|pid:none) Clostridium cellulolyticum H10, ...   147   4e-34
CP000299_139(CP000299|pid:none) Cryptococcus gattii WM276 chromo...   147   4e-34
CP001698_1456(CP001698|pid:none) Spirochaeta thermophila DSM 619...   147   4e-34
HM854815_7(HM854815|pid:none) Cucumis melo subsp. melo clone Cm2...   147   4e-34
CP002868_2450(CP002868|pid:none) Spirochaeta caldaria DSM 7334, ...   147   4e-34
AY542311_13(AY542311|pid:none) Sorghum bicolor clone SB20O07 b1-...   147   4e-34
CP000102_221(CP000102|pid:none) Methanosphaera stadtmanae DSM 30...   147   4e-34
CP000254_951(CP000254|pid:none) Methanospirillum hungatei JF-1, ...   147   6e-34
CP000142_1717(CP000142|pid:none) Pelobacter carbinolicus DSM 238...   147   6e-34
AE008384_2328(AE008384|pid:none) Methanosarcina mazei strain Goe...   147   6e-34
CP002343_2922(CP002343|pid:none) Intrasporangium calvum DSM 4304...   147   6e-34
CP002547_1901(CP002547|pid:none) Syntrophobotulus glycolicus DSM...   147   6e-34
CP002432_893(CP002432|pid:none) Desulfurispirillum indicum S5, c...   147   6e-34
AE2009(AE2009) cation-transporting ATPase alr1627 [imported] - N...   147   6e-34
CP000509_2874(CP000509|pid:none) Nocardioides sp. JS614, complet...   147   6e-34
CP000639_53(CP000639|pid:none) Agrobacterium vitis S4 plasmid pA...   147   6e-34
AP011112_1788(AP011112|pid:none) Hydrogenobacter thermophilus TK...   147   6e-34
BT084644_1(BT084644|pid:none) Zea mays full-length cDNA clone ZM...   147   6e-34
CP002593_1262(CP002593|pid:none) Pseudonocardia dioxanivorans CB...   146   8e-34
CP002858_649(CP002858|pid:none) Flexistipes sinusarabici DSM 494...   146   8e-34
FP929045_1611(FP929045|pid:none) Faecalibacterium prausnitzii L2...   146   8e-34
CP002101_218(CP002101|pid:none) Methanosalsum zhilinae DSM 4017,...   146   8e-34
CP002025_1859(CP002025|pid:none) Brachyspira pilosicoli 95/1000,...   146   8e-34
CP000510_1330(CP000510|pid:none) Psychromonas ingrahamii 37, com...   146   8e-34
CP001964_3615(CP001964|pid:none) Cellulomonas flavigena DSM 2010...   146   8e-34
AP009389_2251(AP009389|pid:none) Pelotomaculum thermopropionicum...   146   1e-33
CP001357_1708(CP001357|pid:none) Brachyspira hyodysenteriae WA1,...   146   1e-33
CP002742_173(CP002742|pid:none) Sinorhizobium meliloti BL225C pl...   146   1e-33
AK354997_1(AK354997|pid:none) Hordeum vulgare subsp. vulgare mRN...   146   1e-33
CP001407_3639(CP001407|pid:none) Bacillus cereus 03BB102, comple...   146   1e-33
CP001832_581(CP001832|pid:none) Sinorhizobium meliloti SM11 plas...   146   1e-33
AK364886_1(AK364886|pid:none) Hordeum vulgare subsp. vulgare mRN...   146   1e-33
CP000742_477(CP000742|pid:none) Methanococcus vannielii SB, comp...   146   1e-33
CP002874_30(CP002874|pid:none) Brachyspira intermedia PWS/A, com...   146   1e-33
AK376255_1(AK376255|pid:none) Hordeum vulgare subsp. vulgare mRN...   146   1e-33
JI166051_1(JI166051|pid:none) TSA: Ascaris suum ASCP_647_3136 mR...   146   1e-33
CP002394_2353(CP002394|pid:none) Bacillus cellulosilyticus DSM 2...   146   1e-33
CP000678_1153(CP000678|pid:none) Methanobrevibacter smithii ATCC...   146   1e-33
CP002770_2517(CP002770|pid:none) Desulfotomaculum kuznetsovii DS...   145   1e-33
CP002032_1561(CP002032|pid:none) Thermoanaerobacter mathranii su...   145   1e-33
CP002050_2533(CP002050|pid:none) Geobacillus sp. C56-T3, complet...   145   1e-33
CP000312_489(CP000312|pid:none) Clostridium perfringens SM101, c...   145   1e-33
(Q9S7J8) RecName: Full=Copper-transporting ATPase RAN1;         ...   145   1e-33
AP008212_1780(AP008212|pid:none) Oryza sativa (japonica cultivar...   145   2e-33
CP002344_1565(CP002344|pid:none) Thermaerobacter marianensis DSM...   145   2e-33
FP929055_1900(FP929055|pid:none) Ruminococcus torques L2-14 draf...   145   2e-33
CP000867_1493(CP000867|pid:none) Methanococcus maripaludis C6, c...   145   2e-33
CP003040_697(CP003040|pid:none) Roseburia hominis A2-183, comple...   145   2e-33
CP000246_513(CP000246|pid:none) Clostridium perfringens ATCC 131...   145   2e-33
CP000155_6442(CP000155|pid:none) Hahella chejuensis KCTC 2396, c...   145   2e-33
AP010655_1535(AP010655|pid:none) Streptococcus mutans NN2025 DNA...   145   2e-33
AC135229_17(AC135229|pid:none) Medicago truncatula clone mth2-7m...   145   2e-33
AE008688_920(AE008688|pid:none) Agrobacterium tumefaciens str. C...   145   2e-33
AY542311_14(AY542311|pid:none) Sorghum bicolor clone SB20O07 b1-...   144   3e-33
AM236085_329(AM236085|pid:none) Rhizobium leguminosarum bv. vici...   144   3e-33
CP001034_1844(CP001034|pid:none) Natranaerobius thermophilus JW/...   144   3e-33
AK367782_1(AK367782|pid:none) Hordeum vulgare subsp. vulgare mRN...   144   3e-33
BA000028_1721(BA000028|pid:none) Oceanobacillus iheyensis HTE831...   144   3e-33
CP001615_1254(CP001615|pid:none) Exiguobacterium sp. AT1b, compl...   144   3e-33
CP001129_433(CP001129|pid:none) Streptococcus equi subsp. zooepi...   144   3e-33
CP000854_1418(CP000854|pid:none) Mycobacterium marinum M, comple...   144   3e-33
CP000103_1991(CP000103|pid:none) Nitrosospira multiformis ATCC 2...   144   3e-33
CP002651_533(CP002651|pid:none) Streptococcus suis ST1, complete...   144   3e-33
CP002360_1213(CP002360|pid:none) Mahella australiensis 50-1 BON,...   144   3e-33
CP002728_1951(CP002728|pid:none) Tepidanaerobacter sp. Re1, comp...   144   3e-33
AK362047_1(AK362047|pid:none) Hordeum vulgare subsp. vulgare mRN...   144   3e-33
CP000831_10(CP000831|pid:none) Dinoroseobacter shibae DFL 12 pla...   144   4e-33
FQ311430_265(FQ311430|pid:none) Sporisorium reilianum SRZ2 chrom...   144   4e-33
AP012044_1730(AP012044|pid:none) Oscillibacter valericigenes Sjm...   144   4e-33
AP012029_1259(AP012029|pid:none) Anaerolinea thermophila UNI-1 D...   144   4e-33
CP002454_263(CP002454|pid:none) Deinococcus maricopensis DSM 212...   144   4e-33
CP001472_1156(CP001472|pid:none) Acidobacterium capsulatum ATCC ...   144   4e-33
CP000860_1803(CP000860|pid:none) Candidatus Desulforudis audaxvi...   144   4e-33
CP003056_2339(CP003056|pid:none) Bacillus coagulans 36D1, comple...   144   4e-33
CP000854_2514(CP000854|pid:none) Mycobacterium marinum M, comple...   144   4e-33
CP001339_434(CP001339|pid:none) Thioalkalivibrio sulfidophilus H...   144   5e-33
CP001115_232(CP001115|pid:none) Deinococcus deserti VCD115 plasm...   144   5e-33
CR936503_1425(CR936503|pid:none) Lactobacillus sakei strain 23K ...   144   5e-33
CP001734_1248(CP001734|pid:none) Desulfohalobium retbaense DSM 5...   144   5e-33
AP009153_2903(AP009153|pid:none) Gemmatimonas aurantiaca T-27 DN...   144   5e-33
AG2278(AG2278) cation-transporting P-type ATPase all3782 [import...   143   6e-33
FR856862_1698(FR856862|pid:none) Novosphingobium sp. PP1Y main c...   143   6e-33
AP008955_374(AP008955|pid:none) Brevibacillus brevis NBRC 100599...   143   6e-33
CP003013_370(CP003013|pid:none) Thielavia terrestris NRRL 8126 c...   143   6e-33
CP000117_1545(CP000117|pid:none) Anabaena variabilis ATCC 29413,...   143   6e-33
U15554_23(U15554|pid:none) Listeria monocytogenes strain DRDC8 h...   143   6e-33
AM114193_101(AM114193|pid:none) Uncultured methanogenic archaeon...   143   6e-33
CP002637_1387(CP002637|pid:none) Selenomonas sputigena ATCC 3518...   143   8e-33
CP000559_1224(CP000559|pid:none) Methanocorpusculum labreanum Z,...   143   8e-33
CP002644_535(CP002644|pid:none) Streptococcus suis D12, complete...   143   8e-33
CU633438_439(CU633438|pid:none) Podospora anserina S mat+ genomi...   143   8e-33
CP003060_3356(CP003060|pid:none) Glaciecola nitratireducens FR10...   143   8e-33
CP000874_1220(CP000874|pid:none) Sinorhizobium fredii NGR234 pla...   143   8e-33
CP001338_630(CP001338|pid:none) Candidatus Methanosphaerula palu...   143   8e-33
CP001899_1331(CP001899|pid:none) Ferroglobus placidus DSM 10642,...   143   8e-33
CP002552_2359(CP002552|pid:none) Nitrosomonas sp. AL212, complet...   143   8e-33
AM946016_1169(AM946016|pid:none) Streptococcus suis P1/7 complet...   143   8e-33
CP000282_1931(CP000282|pid:none) Saccharophagus degradans 2-40, ...   142   1e-32
FN392320_141(FN392320|pid:none) Pichia pastoris GS115 chromosome...   142   1e-32
CP001100_551(CP001100|pid:none) Chloroherpeton thalassium ATCC 3...   142   1e-32
CP001770_1(CP001770|pid:none) Spirosoma linguale DSM 74 plasmid ...   142   1e-32
AP012204_3773(AP012204|pid:none) Microlunatus phosphovorus NM-1 ...   142   1e-32
CP000453_1373(CP000453|pid:none) Alkalilimnicola ehrlichii MLHE-...   142   1e-32
AE017285_2312(AE017285|pid:none) Desulfovibrio vulgaris subsp. v...   142   1e-32
CP002344_1545(CP002344|pid:none) Thermaerobacter marianensis DSM...   142   1e-32
CP002657_3264(CP002657|pid:none) Alicycliphilus denitrificans K6...   142   1e-32
AE010299_165(AE010299|pid:none) Methanosarcina acetivorans str. ...   142   1e-32
CP002085_1991(CP002085|pid:none) Desulfarculus baarsii DSM 2075,...   142   1e-32
CP001629_971(CP001629|pid:none) Desulfomicrobium baculatum DSM 4...   142   1e-32
AF296446_2(AF296446|pid:none) Streptococcus mutans copper transp...   142   1e-32
CP001160_26(CP001160|pid:none) Thalassiosira pseudonana CCMP1335...   142   1e-32
CP000082_1587(CP000082|pid:none) Psychrobacter arcticus 273-4, c...   142   1e-32
CP000527_931(CP000527|pid:none) Desulfovibrio vulgaris DP4, comp...   142   1e-32
CP000724_3166(CP000724|pid:none) Alkaliphilus metalliredigens QY...   142   1e-32
CP002156_2327(CP002156|pid:none) Parvularcula bermudensis HTCC25...   142   1e-32
AE2538(AE2538) cation transporting ATPase all7592 [imported] - N...   142   1e-32
CP000539_1456(CP000539|pid:none) Acidovorax sp. JS42, complete g...   142   1e-32
CP000127_1461(CP000127|pid:none) Nitrosococcus oceani ATCC 19707...   142   1e-32
CP001798_1602(CP001798|pid:none) Nitrosococcus halophilus Nc4, c...   142   1e-32
AM408590_1026(AM408590|pid:none) Mycobacterium bovis BCG Pasteur...   142   1e-32
HE572590_970(HE572590|pid:none) Mycobacterium canettii CIPT 1400...   142   1e-32
CP001641_894(CP001641|pid:none) Mycobacterium tuberculosis CCDC5...   142   1e-32
AE000516_1026(AE000516|pid:none) Mycobacterium tuberculosis CDC1...   142   1e-32
CP002361_559(CP002361|pid:none) Oceanithermus profundus DSM 1497...   142   1e-32
CP000470_6(CP000470|pid:none) Shewanella sp. ANA-3 plasmid 1, co...   142   1e-32
CP002059_1260(CP002059|pid:none) 'Nostoc azollae' 0708, complete...   142   2e-32
GQ900458_16(GQ900458|pid:none) Staphylococcus epidermidis plasmi...   142   2e-32
CP002394_3006(CP002394|pid:none) Bacillus cellulosilyticus DSM 2...   142   2e-32
CP000252_2752(CP000252|pid:none) Syntrophus aciditrophicus SB, c...   142   2e-32
CP000390_3855(CP000390|pid:none) Chelativorans sp. BNC1, complet...   142   2e-32
AP009552_3126(AP009552|pid:none) Microcystis aeruginosa NIES-843...   142   2e-32
CP001720_1942(CP001720|pid:none) Desulfotomaculum acetoxidans DS...   142   2e-32
CP001146_1402(CP001146|pid:none) Dictyoglomus thermophilum H-6-1...   141   2e-32
CP001104_1411(CP001104|pid:none) Eubacterium eligens ATCC 27750,...   141   2e-32
CP001791_1794(CP001791|pid:none) Bacillus selenitireducens MLS10...   141   2e-32
CP002690_425(CP002690|pid:none) Thermodesulfobium narugense DSM ...   141   2e-32
AE017226_8(AE017226|pid:none) Treponema denticola ATCC 35405, co...   141   2e-32
CP000780_783(CP000780|pid:none) Candidatus Methanoregula boonei ...   141   2e-32
CP001339_2486(CP001339|pid:none) Thioalkalivibrio sulfidophilus ...   141   3e-32
CP001905_1899(CP001905|pid:none) Thioalkalivibrio sp. K90mix, co...   141   3e-32
FQ311875_645(FQ311875|pid:none) Arthrobacter arilaitensis RE117 ...   141   3e-32
CP000017_1404(CP000017|pid:none) Streptococcus pyogenes MGAS5005...   141   3e-32
CP001673_1158(CP001673|pid:none) Flavobacteriaceae bacterium 351...   141   3e-32
FM178379_802(FM178379|pid:none) Aliivibrio salmonicida LFI1238 c...   141   3e-32
AE017340_1214(AE017340|pid:none) Idiomarina loihiensis L2TR, com...   141   3e-32
FM204884_1551(FM204884|pid:none) Streptococcus equi subsp. zooep...   141   3e-32
CP002869_6097(CP002869|pid:none) Paenibacillus mucilaginosus KNP...   141   3e-32
CP003075_3808(CP003075|pid:none) Pelagibacterium halotolerans B2...   141   3e-32
AE004092_1317(AE004092|pid:none) Streptococcus pyogenes M1 GAS, ...   141   3e-32
FP929038_36(FP929038|pid:none) Coprococcus catus GD/7 draft geno...   141   3e-32
CP002480_2460(CP002480|pid:none) Granulicella sp. MP5ACTX9, comp...   141   3e-32
AM942444_1313(AM942444|pid:none) Corynebacterium urealyticum DSM...   141   3e-32
FP929059_851(FP929059|pid:none) Eubacterium siraeum V10Sc8a draf...   140   4e-32
CP000648_85(CP000648|pid:none) Klebsiella pneumoniae subsp. pneu...   140   4e-32
AY214164_98(AY214164|pid:none) Escherichia coli plasmid pAPEC-O2...   140   4e-32
CP001029_2515(CP001029|pid:none) Methylobacterium populi BJ001, ...   140   4e-32
CP001068_1624(CP001068|pid:none) Ralstonia pickettii 12J chromos...   140   4e-32
FN543096_60(FN543096|pid:none) Cronobacter turicensis z3032 plas...   140   4e-32
FP929044_395(FP929044|pid:none) Eubacterium siraeum 70/3 draft g...   140   4e-32
CP000782_54(CP000782|pid:none) Xanthobacter autotrophicus Py2 pl...   140   4e-32
CP002893_34(CP002893|pid:none) Escherichia coli UMNF18 plasmid p...   140   4e-32
AP004836_27(AP004836|pid:none) Oryza sativa Japonica Group genom...   140   4e-32
CP002628_636(CP002628|pid:none) Coriobacterium glomerans PW2, co...   140   5e-32
CP001860_136(CP001860|pid:none) Haloterrigena turkmenica DSM 551...   140   5e-32
D16437_1(D16437|pid:none) Synechococcus sp. DNA for PacS, comple...   140   5e-32
CP000606_3811(CP000606|pid:none) Shewanella loihica PV-4, comple...   140   5e-32
CP001827_773(CP001827|pid:none) Dehalococcoides sp. VS, complete...   140   5e-32
AP010935_1698(AP010935|pid:none) Streptococcus dysgalactiae subs...   140   5e-32
CP002086_1496(CP002086|pid:none) Nitrosococcus watsoni C-113, co...   140   5e-32
CU207366_2891(CU207366|pid:none) Gramella forsetii KT0803 comple...   140   5e-32
CP001324_515(CP001324|pid:none) Micromonas sp. RCC299 chromosome...   140   5e-32
CP000449_180(CP000449|pid:none) Maricaulis maris MCS10, complete...   140   5e-32
AE009949_1418(AE009949|pid:none) Streptococcus pyogenes MGAS8232...   140   5e-32
CP001656_2746(CP001656|pid:none) Paenibacillus sp. JDR-2, comple...   140   5e-32
CT573071_7(CT573071|pid:none) Kuenenia stuttgartiensis genome fr...   140   5e-32
CP001291_4268(CP001291|pid:none) Cyanothece sp. PCC 7424, comple...   140   7e-32
CP001710_1130(CP001710|pid:none) Methanothermobacter marburgensi...   140   7e-32
CP001349_779(CP001349|pid:none) Methylobacterium nodulans ORS 20...   140   7e-32
CP001132_2018(CP001132|pid:none) Acidithiobacillus ferrooxidans ...   140   7e-32
FP929046_2580(FP929046|pid:none) Faecalibacterium prausnitzii SL...   140   7e-32
CP000448_1637(CP000448|pid:none) Syntrophomonas wolfei subsp. wo...   140   7e-32
CP001132_2339(CP001132|pid:none) Acidithiobacillus ferrooxidans ...   140   7e-32
AP011532_1308(AP011532|pid:none) Methanocella paludicola SANAE D...   139   9e-32
BA000045_4047(BA000045|pid:none) Gloeobacter violaceus PCC 7421 ...   139   9e-32
CP003068_1371(CP003068|pid:none) Streptococcus pyogenes Alab49, ...   139   9e-32
AM295007_384(AM295007|pid:none) Streptococcus pyogenes Manfredo ...   139   9e-32
CP000685_190(CP000685|pid:none) Flavobacterium johnsoniae UW101,...   139   9e-32
CP000480_4842(CP000480|pid:none) Mycobacterium smegmatis str. MC...   139   9e-32
CP002554_51(CP002554|pid:none) Nitrosomonas sp. AL212 plasmid pN...   139   9e-32
CP000056_1443(CP000056|pid:none) Streptococcus pyogenes MGAS6180...   139   9e-32
CP001842_669(CP001842|pid:none) Cyanobacterium UCYN-A, complete ...   139   9e-32
CP000003_1454(CP000003|pid:none) Streptococcus pyogenes MGAS1039...   139   9e-32
CP000260_1526(CP000260|pid:none) Streptococcus pyogenes MGAS1027...   139   9e-32
CP001229_1084(CP001229|pid:none) Sulfurihydrogenibium azorense A...   139   9e-32
AE014074_1491(AE014074|pid:none) Streptococcus pyogenes MGAS315,...   139   9e-32
AP011116_231(AP011116|pid:none) Rhodococcus opacus B4 plasmid pR...   139   1e-31
CP000259_1406(CP000259|pid:none) Streptococcus pyogenes MGAS9429...   139   1e-31
CP000434_210(CP000434|pid:none) Rhodococcus jostii RHA1 plasmid ...   139   1e-31
CP000323_1770(CP000323|pid:none) Psychrobacter cryohalolentis K5...   139   1e-31
AE000657_777(AE000657|pid:none) Aquifex aeolicus VF5, complete g...   139   1e-31
CP001854_469(CP001854|pid:none) Conexibacter woesei DSM 14684, c...   139   1e-31
AP008231_27(AP008231|pid:none) Synechococcus elongatus PCC 6301 ...   139   1e-31
CP001091_1315(CP001091|pid:none) Actinobacillus pleuropneumoniae...   139   1e-31
FN869568_2854(FN869568|pid:none) Halomonas elongata DSM 2581, co...   139   1e-31
CP001966_1860(CP001966|pid:none) Tsukamurella paurometabola DSM ...   139   1e-31
CP000927_2296(CP000927|pid:none) Caulobacter sp. K31, complete g...   139   1e-31
CP000283_2300(CP000283|pid:none) Rhodopseudomonas palustris BisB...   139   1e-31
AM473693_1(AM473693|pid:none) Vitis vinifera contig VV78X022559....   139   1e-31
CP000854_4809(CP000854|pid:none) Mycobacterium marinum M, comple...   139   1e-31
CP001918_4843(CP001918|pid:none) Enterobacter cloacae subsp. clo...   139   1e-31
BX664015_143(BX664015|pid:none) Serratia marcescens plasmid R478...   139   1e-31
CP001874_2094(CP001874|pid:none) Thermobispora bispora DSM 43833...   139   1e-31
CP001811_51(CP001811|pid:none) Butyrivibrio proteoclasticus B316...   139   1e-31
CP000927_2306(CP000927|pid:none) Caulobacter sp. K31, complete g...   139   1e-31
CP002339_1423(CP002339|pid:none) Alteromonas sp. SN2, complete g...   139   2e-31
CP001681_3030(CP001681|pid:none) Pedobacter heparinus DSM 2366, ...   139   2e-31
CP001801_900(CP001801|pid:none) Halothiobacillus neapolitanus c2...   139   2e-31
CP002345_2119(CP002345|pid:none) Paludibacter propionicigenes WB...   139   2e-31
CP002102_1665(CP002102|pid:none) Brevundimonas subvibrioides ATC...   139   2e-31
CP002565_1109(CP002565|pid:none) Methanosaeta concilii GP-6, com...   139   2e-31
CP000470_162(CP000470|pid:none) Shewanella sp. ANA-3 plasmid 1, ...   139   2e-31
CP002770_3108(CP002770|pid:none) Desulfotomaculum kuznetsovii DS...   139   2e-31
AY142865_1(AY142865|pid:none) Heliobacillus mobilis Copper-impor...   139   2e-31
AJ965256_765(AJ965256|pid:none) Dehalococcoides sp. CBDB1 comple...   139   2e-31
CP001096_1035(CP001096|pid:none) Rhodopseudomonas palustris TIE-...   139   2e-31
AY596297_440(AY596297|pid:none) Haloarcula marismortui ATCC 4304...   139   2e-31
CP000262_1518(CP000262|pid:none) Streptococcus pyogenes MGAS1075...   139   2e-31
CP002390_541(CP002390|pid:none) Filifactor alocis ATCC 35896, co...   139   2e-31
AM920430_149(AM920430|pid:none) Penicillium chrysogenum Wisconsi...   139   2e-31
CP002177_479(CP002177|pid:none) Acinetobacter calcoaceticus PHEA...   138   2e-31
CP001965_1855(CP001965|pid:none) Sideroxydans lithotrophicus ES-...   138   2e-31
CP000521_1299(CP000521|pid:none) Acinetobacter baumannii ATCC 17...   138   2e-31
CP000494_198(CP000494|pid:none) Bradyrhizobium sp. BTAi1, comple...   138   2e-31
CP001983_1804(CP001983|pid:none) Bacillus megaterium QM B1551, c...   138   2e-31
CP000099_1835(CP000099|pid:none) Methanosarcina barkeri str. Fus...   138   2e-31
CU468230_1424(CU468230|pid:none) Acinetobacter baumannii str. SD...   138   2e-31
FJ529690_29(FJ529690|pid:none) Uncultured bacterium URE12 genomi...   138   2e-31
CP000863_1195(CP000863|pid:none) Acinetobacter baumannii ACICU, ...   138   2e-31
CP000325_355(CP000325|pid:none) Mycobacterium ulcerans Agy99, co...   138   2e-31
CP000511_5767(CP000511|pid:none) Mycobacterium vanbaalenii PYR-1...   138   2e-31
FP929052_499(FP929052|pid:none) Ruminococcus sp. 18P13 draft gen...   138   2e-31
CP002921_1115(CP002921|pid:none) Haloarcula hispanica ATCC 33960...   138   3e-31
CP002110_633(CP002110|pid:none) Staphylococcus aureus subsp. aur...   138   3e-31
(Q6GDP1) RecName: Full=Copper-exporting P-type ATPase A;        ...   138   3e-31
BA000028_1142(BA000028|pid:none) Oceanobacillus iheyensis HTE831...   138   3e-31
(A8Z3F8) RecName: Full=Copper-exporting P-type ATPase A;        ...   138   3e-31
FQ859185_2706(FQ859185|pid:none) Streptomyces cattleya str. NRRL...   138   3e-31
CP002305_517(CP002305|pid:none) Leadbetterella byssophila DSM 17...   138   3e-31
(A5IVY3) RecName: Full=Copper-exporting P-type ATPase A;        ...   138   3e-31
CP002114_2404(CP002114|pid:none) Staphylococcus aureus subsp. au...   138   3e-31
AP008957_4359(AP008957|pid:none) Rhodococcus erythropolis PR4 DN...   138   3e-31
(A6QK47) RecName: Full=Copper-exporting P-type ATPase A;        ...   138   3e-31
CP000569_1243(CP000569|pid:none) Actinobacillus pleuropneumoniae...   138   3e-31
CP000388_2076(CP000388|pid:none) Pseudoalteromonas atlantica T6c...   138   3e-31
CP000759_478(CP000759|pid:none) Ochrobactrum anthropi ATCC 49188...   138   3e-31
CP001686_1003(CP001686|pid:none) Kytococcus sedentarius DSM 2054...   138   3e-31
CP000758_286(CP000758|pid:none) Ochrobactrum anthropi ATCC 49188...   137   3e-31
CP002512_77(CP002512|pid:none) Aerococcus urinae ACS-120-V-Col10...   137   3e-31
CP001820_566(CP001820|pid:none) Veillonella parvula DSM 2008, co...   137   3e-31
CP000384_3931(CP000384|pid:none) Mycobacterium sp. MCS, complete...   137   3e-31
AP007150_91(AP007150|pid:none) Aspergillus oryzae RIB40 DNA, SC0...   137   3e-31
CP001932_1829(CP001932|pid:none) Natrialba magadii ATCC 43099, c...   137   3e-31
CP000285_2985(CP000285|pid:none) Chromohalobacter salexigens DSM...   137   3e-31
(Q4A0G1) RecName: Full=Copper-exporting P-type ATPase A;        ...   137   5e-31
CP002657_2644(CP002657|pid:none) Alicycliphilus denitrificans K6...   137   5e-31
CP000481_1648(CP000481|pid:none) Acidothermus cellulolyticus 11B...   137   5e-31
CP000725_1878(CP000725|pid:none) Streptococcus gordonii str. Cha...   137   5e-31
AE1306(AE1306) heavy metal-transporting ATPases homolog lmo1853 ...   137   5e-31
CP000539_2585(CP000539|pid:none) Acidovorax sp. JS42, complete g...   137   5e-31
AE017262_1861(AE017262|pid:none) Listeria monocytogenes str. 4b ...   137   5e-31
CP002593_1246(CP002593|pid:none) Pseudonocardia dioxanivorans CB...   137   5e-31
CP002271_6965(CP002271|pid:none) Stigmatella aurantiaca DW4/3-1,...   137   5e-31
AP012223_88(AP012223|pid:none) Sphingobium sp. SYK-6 plasmid DNA...   137   5e-31
CP002004_1835(CP002004|pid:none) Listeria monocytogenes Finland ...   137   5e-31
CP002002_1814(CP002002|pid:none) Listeria monocytogenes 10403S, ...   137   5e-31
CP001940_2092(CP001940|pid:none) Desulfurivibrio alkaliphilus AH...   137   5e-31
AY210894_1(AY210894|pid:none) Trametes versicolor copper P-type ...   137   5e-31
CP002541_967(CP002541|pid:none) Spirochaeta sp. Buddy, complete ...   137   5e-31
CP001197_3144(CP001197|pid:none) Desulfovibrio vulgaris str. 'Mi...   137   6e-31
CP000688_828(CP000688|pid:none) Dehalococcoides sp. BAV1, comple...   137   6e-31
CP001684_123(CP001684|pid:none) Slackia heliotrinireducens DSM 2...   137   6e-31
FP475956_1889(FP475956|pid:none) Thiomonas sp. str. 3As chromoso...   137   6e-31
AE010300_479(AE010300|pid:none) Leptospira interrogans serovar L...   137   6e-31
CP000495_101(CP000495|pid:none) Bradyrhizobium sp. BTAi1 plasmid...   137   6e-31
FP475956_2932(FP475956|pid:none) Thiomonas sp. str. 3As chromoso...   137   6e-31
CP001111_1769(CP001111|pid:none) Stenotrophomonas maltophilia R5...   137   6e-31
CP000471_992(CP000471|pid:none) Magnetococcus sp. MC-1, complete...   137   6e-31
CP000782_113(CP000782|pid:none) Xanthobacter autotrophicus Py2 p...   137   6e-31
CP002343_204(CP002343|pid:none) Intrasporangium calvum DSM 43043...   137   6e-31
CP000319_3262(CP000319|pid:none) Nitrobacter hamburgensis X14, c...   137   6e-31

>AC116984_190(AC116984|pid:none) Dictyostelium discoideum chromosome 2
            map 2567470-3108875 strain AX4, complete sequence.
          Length = 1280

 Score =  324 bits (830), Expect = 3e-87
 Identities = 168/168 (100%), Positives = 168/168 (100%)
 Frame = +2

Query: 59   ILFKGIMSISDIPRDDSKRAIKKLKSMGLKCYMVTGDNKRAAKFIANQVGIDEDHIYSEV 238
            ILFKGIMSISDIPRDDSKRAIKKLKSMGLKCYMVTGDNKRAAKFIANQVGIDEDHIYSEV
Sbjct: 1083 ILFKGIMSISDIPRDDSKRAIKKLKSMGLKCYMVTGDNKRAAKFIANQVGIDEDHIYSEV 1142

Query: 239  IPKEKAEKVSDLQASGNVVCFVGDGVNDSPALSQADVGISVATGTDIAIESSSIVLLKNS 418
            IPKEKAEKVSDLQASGNVVCFVGDGVNDSPALSQADVGISVATGTDIAIESSSIVLLKNS
Sbjct: 1143 IPKEKAEKVSDLQASGNVVCFVGDGVNDSPALSQADVGISVATGTDIAIESSSIVLLKNS 1202

Query: 419  LTDVYRSIHLSRVVFRRIKINFTLALIYNLCAVPLAAGLFRVIFGVSL 562
            LTDVYRSIHLSRVVFRRIKINFTLALIYNLCAVPLAAGLFRVIFGVSL
Sbjct: 1203 LTDVYRSIHLSRVVFRRIKINFTLALIYNLCAVPLAAGLFRVIFGVSL 1250

Lambda     K      H
   0.318    0.134    0.401

Gapped
Lambda     K      H
   0.267   0.0410    0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 5349213
Number of Hits to DB: 1,301,166,701
Number of extensions: 22034937
Number of successful extensions: 76347
Number of sequences better than 10.0: 5828
Number of HSP's gapped: 70821
Number of HSP's successfully gapped: 6355
Length of query: 223
Length of database: 1,732,582,204
Length adjustment: 127
Effective length of query: 96
Effective length of database: 1,053,232,153
Effective search space: 101110286688
Effective search space used: 101110286688
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 31 (16.5 bits)




Dictyostelium discoideum cDNA Project Home