Homology FC-IC1475 vs Protein

Query= FC-IC1475 (FC-IC1475Q) /CSM/FC-IC/FC-IC1475Q.Seq.d/
         (390 letters)

Database: nrp_B
           5,349,213 sequences; 1,732,582,204 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

HE601628_128(HE601628|pid:none) Schistosoma mansoni strain Puert...    42   0.014
AE010299_1578(AE010299|pid:none) Methanosarcina acetivorans str....    38   0.21
CP000930_2260(CP000930|pid:none) Heliobacterium modesticaldum Ic...    37   0.47
GU474883_37(GU474883|pid:none) Uncultured delta proteobacterium ...    35   1.4
GU474879_27(GU474879|pid:none) Uncultured delta proteobacterium ...    35   1.4
GU474881_38(GU474881|pid:none) Uncultured Acidobacteriales bacte...    35   1.4
GU474914_23(GU474914|pid:none) Uncultured delta proteobacterium ...    35   1.8
CP000423_1127(CP000423|pid:none) Lactobacillus casei ATCC 334, c...    33   5.1
GU474896_16(GU474896|pid:none) Uncultured Acidobacteria bacteriu...    33   5.1
CP002616_1370(CP002616|pid:none) Lactobacillus casei LC2W, compl...    33   5.1
CP001084_1137(CP001084|pid:none) Lactobacillus casei str. Zhang,...    33   5.1
FN543107_180(FN543107|pid:none) Curvibacter putative symbiont of...    33   6.7
GU474869_40(GU474869|pid:none) Uncultured delta proteobacterium ...    33   6.7
AP011548_1170(AP011548|pid:none) Lactobacillus rhamnosus ATCC 53...    32   8.8

>HE601628_128(HE601628|pid:none) Schistosoma mansoni strain Puerto
           Rico chromosome 5, complete genome.
          Length = 64

 Score = 41.6 bits (96), Expect = 0.014
 Identities = 20/33 (60%), Positives = 25/33 (75%)
 Frame = -2

Query: 146 GLNLGLFRLHSPLLTES*LVSFPPLTDMLKFSG 48
           G  + L  +HS LL +S LVSFPPL+DMLKF+G
Sbjct: 32  GFGVRLIPVHSQLLGKSLLVSFPPLSDMLKFNG 64

Lambda     K      H
   0.318    0.134    0.401

Gapped
Lambda     K      H
   0.267   0.0410    0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 5349213
Number of Hits to DB: 1,068,483,953
Number of extensions: 21239567
Number of successful extensions: 32117
Number of sequences better than 10.0: 14
Number of HSP's gapped: 32115
Number of HSP's successfully gapped: 14
Length of query: 130
Length of database: 1,732,582,204
Length adjustment: 95
Effective length of query: 35
Effective length of database: 1,224,406,969
Effective search space: 42854243915
Effective search space used: 42854243915
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 29 (15.8 bits)