Homology FC-IC0461 vs Protein

Query= FC-IC0461 (FC-IC0461Q) /CSM/FC-IC/FC-IC0461Q.Seq.d/
         (380 letters)

Database: nrp_B
           5,349,213 sequences; 1,732,582,204 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

HE601628_128(HE601628|pid:none) Schistosoma mansoni strain Puert...    39   0.095
AE010299_1578(AE010299|pid:none) Methanosarcina acetivorans str....    35   1.1
CP000930_2260(CP000930|pid:none) Heliobacterium modesticaldum Ic...    34   3.1
CP000423_1127(CP000423|pid:none) Lactobacillus casei ATCC 334, c...    33   5.2
CP002616_1370(CP002616|pid:none) Lactobacillus casei LC2W, compl...    33   5.2
CP001084_1137(CP001084|pid:none) Lactobacillus casei str. Zhang,...    33   5.2
GU474881_38(GU474881|pid:none) Uncultured Acidobacteriales bacte...    33   5.2
GU474883_37(GU474883|pid:none) Uncultured delta proteobacterium ...    33   6.8
GU474879_27(GU474879|pid:none) Uncultured delta proteobacterium ...    33   6.8
GU474914_23(GU474914|pid:none) Uncultured delta proteobacterium ...    32   8.9
AP011548_1170(AP011548|pid:none) Lactobacillus rhamnosus ATCC 53...    32   8.9

>HE601628_128(HE601628|pid:none) Schistosoma mansoni strain Puerto
           Rico chromosome 5, complete genome.
          Length = 64

 Score = 38.9 bits (89), Expect = 0.095
 Identities = 19/33 (57%), Positives = 24/33 (72%)
 Frame = -1

Query: 146 GLNLGLFRLHSPLLTES*LVSFPPLTDMLKXSG 48
           G  + L  +HS LL +S LVSFPPL+DMLK +G
Sbjct: 32  GFGVRLIPVHSQLLGKSLLVSFPPLSDMLKFNG 64

Lambda     K      H
   0.318    0.134    0.401

Gapped
Lambda     K      H
   0.267   0.0410    0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 5349213
Number of Hits to DB: 1,019,144,204
Number of extensions: 19308176
Number of successful extensions: 30304
Number of sequences better than 10.0: 11
Number of HSP's gapped: 30302
Number of HSP's successfully gapped: 11
Length of query: 126
Length of database: 1,732,582,204
Length adjustment: 91
Effective length of query: 35
Effective length of database: 1,245,803,821
Effective search space: 43603133735
Effective search space used: 43603133735
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 29 (15.8 bits)