Homology CHB609 vs Protein
Query= CHB609 (CHB609Q) /CSM/CH/CHB6-A/CHB609Q.Seq.d/
(1103 letters)
Database: nrp_B
5,349,213 sequences; 1,732,582,204 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AP011745_41(AP011745|pid:none) Candidatus Caldiarchaeum subterra... 44 2e-06
CP000815_263(CP000815|pid:none) Paulinella chromatophora chromat... 45 0.006
BA000039_142(BA000039|pid:none) Thermosynechococcus elongatus BP... 44 0.012
CP000751_60(CP000751|pid:none) Kineococcus radiotolerans SRS3021... 35 0.017
CP001399_484(CP001399|pid:none) Sulfolobus islandicus L.S.2.15, ... 38 0.024
CP001401_476(CP001401|pid:none) Sulfolobus islandicus M.16.27, c... 38 0.024
CP000435_2497(CP000435|pid:none) Synechococcus sp. CC9311, compl... 43 0.036
CP001630_5856(CP001630|pid:none) Actinosynnema mirum DSM 43827, ... 42 0.047
AY223810_107(AY223810|pid:none) Rhodococcus erythropolis linear ... 42 0.047
AE009441_897(AE009441|pid:none) Pyrobaculum aerophilum str. IM2,... 31 0.054
CP001403_479(CP001403|pid:none) Sulfolobus islandicus Y.G.57.14,... 36 0.11
CP003098_1071(CP003098|pid:none) Pyrobaculum sp. 1860, complete ... 33 0.14
BA000045_2112(BA000045|pid:none) Gloeobacter violaceus PCC 7421 ... 40 0.18
CP001339_1567(CP001339|pid:none) Thioalkalivibrio sulfidophilus ... 40 0.23
AE006641_1469(AE006641|pid:none) Sulfolobus solfataricus P2, com... 36 0.24
CP001404_2280(CP001404|pid:none) Sulfolobus islandicus Y.N.15.51... 35 0.24
CP000553_173(CP000553|pid:none) Prochlorococcus marinus str. NAT... 40 0.31
CP001472_2858(CP001472|pid:none) Acidobacterium capsulatum ATCC ... 39 0.40
AE006641_1710(AE006641|pid:none) Sulfolobus solfataricus P2, com... 39 0.40
BX569694_119(BX569694|pid:none) Synechococcus sp. WH8102 complet... 39 0.52
CP000552_114(CP000552|pid:none) Prochlorococcus marinus str. MIT... 39 0.68
CP000509_404(CP000509|pid:none) Nocardioides sp. JS614, complete... 30 0.80
CP002100_338(CP002100|pid:none) Vulcanisaeta distributa DSM 1442... 30 0.84
AP011615_3136(AP011615|pid:none) Arthrospira platensis NIES-39, ... 38 0.89
CP000117_637(CP000117|pid:none) Anabaena variabilis ATCC 29413, ... 38 0.89
AE017126_120(AE017126|pid:none) Prochlorococcus marinus subsp. m... 38 0.89
CP000777_830(CP000777|pid:none) Leptospira biflexa serovar Patoc... 33 1.3
CP001964_1022(CP001964|pid:none) Cellulomonas flavigena DSM 2010... 33 1.3
CP001291_460(CP001291|pid:none) Cyanothece sp. PCC 7424, complet... 37 2.6
CP000239_2486(CP000239|pid:none) Synechococcus sp. JA-3-3Ab, com... 37 2.6
CP001631_220(CP001631|pid:none) Acidimicrobium ferrooxidans DSM ... 36 3.4
CP000554_216(CP000554|pid:none) Prochlorococcus marinus str. MIT... 36 3.4
CP001706_831(CP001706|pid:none) Jonesia denitrificans DSM 20603,... 32 3.7
BT120531_1(BT120531|pid:none) Lepeophtheirus salmonis clone lsal... 31 3.8
CP001814_4716(CP001814|pid:none) Streptosporangium roseum DSM 43... 36 4.4
AK359170_1(AK359170|pid:none) Hordeum vulgare subsp. vulgare mRN... 35 5.8
AK354419_1(AK354419|pid:none) Hordeum vulgare subsp. vulgare mRN... 35 5.8
AK357523_1(AK357523|pid:none) Hordeum vulgare subsp. vulgare mRN... 35 5.8
CP002452_542(CP002452|pid:none) Nitratifractor salsuginis DSM 16... 35 5.8
CP001802_2532(CP001802|pid:none) Gordonia bronchialis DSM 43247,... 31 6.2
AP008931_125(AP008931|pid:none) Rhodococcus erythropolis PR4 pla... 35 7.5
BX548175_194(BX548175|pid:none) Prochlorococcus marinus MIT9313 ... 35 7.5
CT971583_2205(CT971583|pid:none) Synechococcus WH7803 complete g... 35 7.5
CP002665_2464(CP002665|pid:none) [Cellvibrio] gilvus ATCC 13127,... 27 7.9
CP003098_2561(CP003098|pid:none) Pyrobaculum sp. 1860, complete ... 27 9.2
AP012204_5238(AP012204|pid:none) Microlunatus phosphovorus NM-1 ... 35 9.8
>AP011745_41(AP011745|pid:none) Candidatus Caldiarchaeum
subterraneum DNA, fosmid clone: JFF037_B02.
Length = 130
Score = 43.5 bits (101), Expect(2) = 2e-06
Identities = 15/32 (46%), Positives = 23/32 (71%)
Frame = +1
Query: 265 CDINATLSCTSVIKSEYGKIFGVPVSYYGITW 360
C+I++ LSC +V+ S Y K GVP ++YG+ W
Sbjct: 29 CEISSFLSCDTVLSSPYAKFLGVPTAFYGVVW 60
Score = 33.1 bits (74), Expect(2) = 2e-06
Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 1/42 (2%)
Frame = +2
Query: 440 WCSIGIGFVFYFIAAEL-IIGKICPFCTLVHIINVALMYLVF 562
W IG+ V + EL +IG +C CT H + VA+ L F
Sbjct: 84 WSVIGVAVVAVLVYVELGLIGAVCILCTAAHAMTVAVAALSF 125
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 5349213
Number of Hits to DB: 2,803,691,611
Number of extensions: 55808788
Number of successful extensions: 106828
Number of sequences better than 10.0: 46
Number of HSP's gapped: 106790
Number of HSP's successfully gapped: 64
Length of query: 367
Length of database: 1,732,582,204
Length adjustment: 133
Effective length of query: 234
Effective length of database: 1,021,136,875
Effective search space: 238946028750
Effective search space used: 238946028750
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)
Dictyostelium discoideum cDNA Project Home