Homology CHB609 vs Protein

Query= CHB609 (CHB609Q) /CSM/CH/CHB6-A/CHB609Q.Seq.d/
         (1103 letters)

Database: nrp_B
           5,349,213 sequences; 1,732,582,204 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AP011745_41(AP011745|pid:none) Candidatus Caldiarchaeum subterra...    44   2e-06
CP000815_263(CP000815|pid:none) Paulinella chromatophora chromat...    45   0.006
BA000039_142(BA000039|pid:none) Thermosynechococcus elongatus BP...    44   0.012
CP000751_60(CP000751|pid:none) Kineococcus radiotolerans SRS3021...    35   0.017
CP001399_484(CP001399|pid:none) Sulfolobus islandicus L.S.2.15, ...    38   0.024
CP001401_476(CP001401|pid:none) Sulfolobus islandicus M.16.27, c...    38   0.024
CP000435_2497(CP000435|pid:none) Synechococcus sp. CC9311, compl...    43   0.036
CP001630_5856(CP001630|pid:none) Actinosynnema mirum DSM 43827, ...    42   0.047
AY223810_107(AY223810|pid:none) Rhodococcus erythropolis linear ...    42   0.047
AE009441_897(AE009441|pid:none) Pyrobaculum aerophilum str. IM2,...    31   0.054
CP001403_479(CP001403|pid:none) Sulfolobus islandicus Y.G.57.14,...    36   0.11
CP003098_1071(CP003098|pid:none) Pyrobaculum sp. 1860, complete ...    33   0.14
BA000045_2112(BA000045|pid:none) Gloeobacter violaceus PCC 7421 ...    40   0.18
CP001339_1567(CP001339|pid:none) Thioalkalivibrio sulfidophilus ...    40   0.23
AE006641_1469(AE006641|pid:none) Sulfolobus solfataricus P2, com...    36   0.24
CP001404_2280(CP001404|pid:none) Sulfolobus islandicus Y.N.15.51...    35   0.24
CP000553_173(CP000553|pid:none) Prochlorococcus marinus str. NAT...    40   0.31
CP001472_2858(CP001472|pid:none) Acidobacterium capsulatum ATCC ...    39   0.40
AE006641_1710(AE006641|pid:none) Sulfolobus solfataricus P2, com...    39   0.40
BX569694_119(BX569694|pid:none) Synechococcus sp. WH8102 complet...    39   0.52
CP000552_114(CP000552|pid:none) Prochlorococcus marinus str. MIT...    39   0.68
CP000509_404(CP000509|pid:none) Nocardioides sp. JS614, complete...    30   0.80
CP002100_338(CP002100|pid:none) Vulcanisaeta distributa DSM 1442...    30   0.84
AP011615_3136(AP011615|pid:none) Arthrospira platensis NIES-39, ...    38   0.89
CP000117_637(CP000117|pid:none) Anabaena variabilis ATCC 29413, ...    38   0.89
AE017126_120(AE017126|pid:none) Prochlorococcus marinus subsp. m...    38   0.89
CP000777_830(CP000777|pid:none) Leptospira biflexa serovar Patoc...    33   1.3
CP001964_1022(CP001964|pid:none) Cellulomonas flavigena DSM 2010...    33   1.3
CP001291_460(CP001291|pid:none) Cyanothece sp. PCC 7424, complet...    37   2.6
CP000239_2486(CP000239|pid:none) Synechococcus sp. JA-3-3Ab, com...    37   2.6
CP001631_220(CP001631|pid:none) Acidimicrobium ferrooxidans DSM ...    36   3.4
CP000554_216(CP000554|pid:none) Prochlorococcus marinus str. MIT...    36   3.4
CP001706_831(CP001706|pid:none) Jonesia denitrificans DSM 20603,...    32   3.7
BT120531_1(BT120531|pid:none) Lepeophtheirus salmonis clone lsal...    31   3.8
CP001814_4716(CP001814|pid:none) Streptosporangium roseum DSM 43...    36   4.4
AK359170_1(AK359170|pid:none) Hordeum vulgare subsp. vulgare mRN...    35   5.8
AK354419_1(AK354419|pid:none) Hordeum vulgare subsp. vulgare mRN...    35   5.8
AK357523_1(AK357523|pid:none) Hordeum vulgare subsp. vulgare mRN...    35   5.8
CP002452_542(CP002452|pid:none) Nitratifractor salsuginis DSM 16...    35   5.8
CP001802_2532(CP001802|pid:none) Gordonia bronchialis DSM 43247,...    31   6.2
AP008931_125(AP008931|pid:none) Rhodococcus erythropolis PR4 pla...    35   7.5
BX548175_194(BX548175|pid:none) Prochlorococcus marinus MIT9313 ...    35   7.5
CT971583_2205(CT971583|pid:none) Synechococcus WH7803 complete g...    35   7.5
CP002665_2464(CP002665|pid:none) [Cellvibrio] gilvus ATCC 13127,...    27   7.9
CP003098_2561(CP003098|pid:none) Pyrobaculum sp. 1860, complete ...    27   9.2
AP012204_5238(AP012204|pid:none) Microlunatus phosphovorus NM-1 ...    35   9.8

>AP011745_41(AP011745|pid:none) Candidatus Caldiarchaeum
           subterraneum DNA, fosmid clone: JFF037_B02.
          Length = 130

 Score = 43.5 bits (101), Expect(2) = 2e-06
 Identities = 15/32 (46%), Positives = 23/32 (71%)
 Frame = +1

Query: 265 CDINATLSCTSVIKSEYGKIFGVPVSYYGITW 360
           C+I++ LSC +V+ S Y K  GVP ++YG+ W
Sbjct: 29  CEISSFLSCDTVLSSPYAKFLGVPTAFYGVVW 60

 Score = 33.1 bits (74), Expect(2) = 2e-06
 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 1/42 (2%)
 Frame = +2

Query: 440 WCSIGIGFVFYFIAAEL-IIGKICPFCTLVHIINVALMYLVF 562
           W  IG+  V   +  EL +IG +C  CT  H + VA+  L F
Sbjct: 84  WSVIGVAVVAVLVYVELGLIGAVCILCTAAHAMTVAVAALSF 125

Lambda     K      H
   0.318    0.134    0.401

Gapped
Lambda     K      H
   0.267   0.0410    0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 5349213
Number of Hits to DB: 2,803,691,611
Number of extensions: 55808788
Number of successful extensions: 106828
Number of sequences better than 10.0: 46
Number of HSP's gapped: 106790
Number of HSP's successfully gapped: 64
Length of query: 367
Length of database: 1,732,582,204
Length adjustment: 133
Effective length of query: 234
Effective length of database: 1,021,136,875
Effective search space: 238946028750
Effective search space used: 238946028750
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)




Dictyostelium discoideum cDNA Project Home