Homology CFE740 vs Protein

Query= CFE740 (CFE740Q) /CSM/CF/CFE7-B/CFE740Q.Seq.d/
         (869 letters)

Database: nrp_B
           5,349,213 sequences; 1,732,582,204 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

(Q54GD0) RecName: Full=Mental retardation GTPase activating prot...    37   1.8
CP001370_57(CP001370|pid:none) Borrelia burgdorferi 72a plasmid ...    36   2.3
CP001257_55(CP001257|pid:none) Borrelia burgdorferi 156a plasmid...    36   2.3
CP001421_56(CP001421|pid:none) Borrelia burgdorferi 64b plasmid ...    36   2.3
AE000790_64(AE000790|pid:none) Borrelia burgdorferi B31 plasmid ...    36   2.3
CP001199_45(CP001199|pid:none) Borrelia burgdorferi ZS7 plasmid ...    36   2.3
CP001524_57(CP001524|pid:none) Borrelia sp. SV1 plasmid SV1_lp54...    35   4.0
S51623(S51623)cut14 protein - fission yeast (Schizosaccharomyces...    35   5.2
D30787_1(D30787|pid:none) Schizosaccharomyces pombe gene for cut...    35   5.2
AL844503_64(AL844503|pid:none) Plasmodium falciparum 3D7 chromos...    34   8.9

>(Q54GD0) RecName: Full=Mental retardation GTPase activating protein
           homolog 1; AltName: Full=GTPase activating factor for
           raC protein BB; AltName: Full=Rho GTPase-activating
           protein gacBB;
          Length = 920

 Score = 36.6 bits (83), Expect = 1.8
 Identities = 19/64 (29%), Positives = 34/64 (53%)
 Frame = +1

Query: 4   RMQKMKTNLKKYITEFESIPQKQQQSIKDSEELINSIDTKQDIQSFTNFNKTLNTPTPDF 183
           R++ MK+N++ YI   + IPQ  Q  I  ++  ++ ID + D+Q++   N         F
Sbjct: 303 RLEIMKSNIRNYIGFMKDIPQALQCEIDSTKGFVDIIDPEVDLQNYIMNNSNPKKVLLPF 362

Query: 184 QFES 195
            FE+
Sbjct: 363 IFEA 366

Lambda     K      H
   0.318    0.134    0.401

Gapped
Lambda     K      H
   0.267   0.0410    0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 5349213
Number of Hits to DB: 1,473,480,160
Number of extensions: 18456747
Number of successful extensions: 40536
Number of sequences better than 10.0: 10
Number of HSP's gapped: 40525
Number of HSP's successfully gapped: 10
Length of query: 289
Length of database: 1,732,582,204
Length adjustment: 130
Effective length of query: 159
Effective length of database: 1,037,184,514
Effective search space: 164912337726
Effective search space used: 164912337726
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)