Translated Amino Acid Sequence AFF409

Frame A:
lck*kdhlketqiqnltnthritqlssvfnk*innkyi*vkengl*mvfycinkffigss
kyshtl*kec*nnk*rttkryisirkn**dgrsrrfgccfifkyfryqqx*fklkqx*fk
qf*fqlk---

---xxxsssssssssss*xxkxiiixkxkxxiimkxexkxiimkxkmkmxixkxxxxxql
iiiiixxxkliiixxxixxk*xkxxixxkqxkxxixxx*xxxxxxxixmkxlxxkqlxxx
lxxkqlixxxxxxlkxkqxxxxlxxklfixxkxxxkllixxxlxixxxiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiklkqlikfklkqf
*lkqf*fkgenxfkxyn

Frame B:
yanrkiiskkhkyrisqthte*rnfpvflink*IINIYKSKKMDSKWFFIVLISFLLVLP
SIVTPYRKSVEITNEEPQRDIYQLEKTNKMAEVGDLGVASFLNILDTSXSSSSSSXXSSS
SSSSSSS---

---xxxhhhhhhhhhhhexarxsssxx*rxxss*xxxxrxss*sxr*r*xsxsxxxxxss
sssssxsxs*sssxxxsxxsxxxcxsxxssxxcxsxxssxxxxxcxsx*xxsxxss*xxx
sxxss*sxsxxxxsxxssxxxxsxxscssxxxxxxsxssxxsxssxsxssssssssssss
ssssssssssssssssssssssssssssssssssssssssssssssssssssssssssss
sssssssrektnlkxii

Frame C:
mqierssqrntnteshkhtqnnatfqcf**ink**iyisqrkwtlngflly**vfywffq
v*shliervlk*qmknhkeiyin*kklirwqk*eiwvllhf*if*ipaxlvqaqaxlvqa
vlvpaqa---

---XXIIIIIIIIIIIMKXQDXHHXEXEDXXHHEXGXEDXHHEVEDEDDXHXAXXXXAAH
HHHHXXAEVDHHXDXXXDXVXEXVXXDXAAEXVXXXXVVDXVVXVXXDEXXXXEAVDXXX
XXXAVDXXVXXXXQXXAVDXXXXAEAVHXXEXXXEAXHXXXAXHXXAXHHHHHHHHHHHH
HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHQAQAAHQVQAQAVL
AQAVLVQGRKXI*xi*y


Dictyostelium discoideum cDNA Project Home